KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05360Help
Entry
BMULJ_05360       CDS       T00740                                 

Gene name
parA3
Definition
(GenBank) chromosome partitioning protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_31 CbiA ParA CBP_BcsQ MipZ VirC1 Fer4_NifH ArsA_ATPase ArgK AAA_25 DUF1611 RcsC APS_kinase CLP1_P TrwB_AAD_bind KTI12 AAA_24
Motif
Other DBs
NCBI-ProteinID: BAG47197
UniProt: A0A0H3KXQ4
Position
2:2468150..2468812
Genome map
AA seq 220 aa AA seqDB search
MAAEIIAVTQQKGGVGKSTIAMHLGAAFHEKGKRVLVIDADGQNTLVHWSSASGDGDNGI
PFPVVNLAEAGGQIHREIKKFINDYDIIVVDCPPSITEKVSGVVLLAASIAVIPTSSSPA
DYWSSVGLVKLIQQAQVMNEDLRAVFLLNKTEEKRMLTRELKRALEELGFPLLKTQIPTR
EAYKQAMALGQTVLQMNDRGAKLAAAEIRACADEIVAMLP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttggccgcagaaatcattgcagtcactcaacaaaaaggcggtgtcggcaaaagcacgatc
gccatgcatctcggtgccgcattccatgaaaaaggaaaacgcgtcctcgtcatcgatgca
gacggccaaaacacactggttcattggtccagcgcatcgggcgacggcgacaacggcatt
cctttccccgtcgtcaatctcgcggaagcgggcggccagatccaccgcgagatcaagaag
ttcatcaacgactacgacatcatcgtcgtcgactgcccgccgtcgatcaccgagaaggtc
tcgggcgtcgtcctgctggcggcatcgattgccgtgattcccacgtcgtcgtcgccggcc
gattattggtcgagcgtcgggctcgtgaagctgatccagcaggcgcaggtgatgaacgaa
gacctgcgagcggtattcctgctgaacaagaccgaggaaaagcggatgctgacgcgcgaa
ctgaagcgcgcgctcgaagaactcggcttcccgctgttgaagacgcaaatccccacccgc
gaagcgtacaagcaggccatggcgctcggccagaccgtcctgcagatgaacgatcgcggc
gccaagctcgcggccgcggaaattcgcgcatgtgccgacgaaatcgtcgcgatgctgccc
tga

DBGET integrated database retrieval system