KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05362Help
Entry
BMULJ_05362       CDS       T00740                                 

Gene name
repA3
Definition
(GenBank) replication protein
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rep_3
Motif
Other DBs
NCBI-ProteinID: BAG47199
UniProt: A0A0H3KPA7
Position
2:complement(2469976..2471340)
Genome map
AA seq 454 aa AA seqDB search
MATKRAKKTDVDVVSASSAELRKAVEAIAIQPKSGKITLLTRKLFNVLLAVAQQADDSGD
TYRALLSDIVANSAFDSNDTALVKEHLRRMVSVQVEWSTGTSSQKPGRKWGISTLIADAE
ILEDPATRRVWVEFSFAPKIKKKLLDPVQYARLSLQFQSQLRSSAGLALYEICVRYLTNP
SHLTMREPWEWWRPILSGTPDTEAGDEAKREYKYFKRDYLRPAIAEVNAVTNIFVELIEH
REGRRVAEIQFRVTERKQPMLALDEHPNVFDSTLVDRMVKLGIPLKEAQTLYADSEENRI
RAALQMTEQRMRSTTLPPVRSAAALFKDALKKGYAPPVDAVDALPAAAPSAKGTAAQPDD
LKARLLSEFAAFRRKEAKVLYEEQGELEREVARESFEAEALPTLGTHLRDDWRKRGLESK
LAETAFFDWLAQKTWGEPTDGDLLAFTLNQSRAA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaagcgcgccaagaaaaccgatgtggatgtggtgagtgccagttcagccgaa
ttgcggaaggccgtcgaggcaatcgcaattcagccgaagagcggcaagatcacgctcctg
actcgcaagctgttcaatgtcctgctcgccgtcgcgcagcaggccgacgactcgggcgat
acgtatcgcgcgctgttgtcggacatcgtcgccaactccgcattcgactcgaacgacacc
gcgctggtgaaggagcatctgcgccggatggtgtcggtgcaggtcgaatggagcacgggc
acgtcgagccagaagcccggccgcaaatggggcatctccacgctgatcgccgacgccgaa
attctcgaagatccggctacacggcgcgtgtgggtcgaattttcgttcgcgccgaagatc
aagaagaagctgctcgatccggtgcagtatgcgcgcctgagcctgcagttccagagccag
ctgcgcagcagcgccggcctcgcgctctacgagatctgcgtgcgctatctgacgaacccg
agccacctgacgatgcgcgagccgtgggaatggtggcggccgattctgtcgggcacgccc
gacacggaagccggcgacgaagcgaagcgcgagtacaagtacttcaagcgcgactatctg
cgcccggcgatcgccgaggtcaacgcggtcaccaatatcttcgtcgagctgatcgagcat
cgcgaagggcgacgagtggccgagatccagttccgcgtgaccgagcgcaagcaaccgatg
ctggcgctcgacgagcatccgaacgtcttcgacagcacgctggtcgaccggatggtgaag
ctcggcatcccgctgaaggaagcgcagacgctctatgcggacagcgaagagaaccgtatc
cgcgcagcgttgcagatgaccgagcaacgcatgcgcagcacgacactgccgccggtgcgc
agcgccgccgcgttgttcaaggatgcgttgaagaagggctatgcgccgccggtcgatgcg
gtcgacgcactgccggccgcggcgccgtcggcgaagggcactgcggctcagccggacgat
ctgaaggcgcggctcctcagcgagttcgcggcgttccgccgcaaggaagcgaaggtgctg
tacgaggaacagggcgagctggagcgcgaagtggcgcgcgagtcgttcgaggcggaagcg
ctgccgacgctcggcacgcatctgcgcgacgactggcgcaagcgcgggctcgaatccaag
ctggccgagacggccttcttcgactggctggcccagaagacctggggcgagccgaccgac
ggcgatctgctcgcatttacgctgaaccagtccagggctgcgtaa

DBGET integrated database retrieval system