KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05627Help
Entry
BMULJ_05627       CDS       T00740                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00430  Taurine and hypotaurine metabolism
bmj00620  Pyruvate metabolism
bmj00640  Propanoate metabolism
bmj00680  Methane metabolism
bmj01100  Metabolic pathways
bmj01120  Microbial metabolism in diverse environments
bmj01200  Carbon metabolism
Module
bmj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_05627 (ackA)
   00640 Propanoate metabolism
    BMULJ_05627 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BMULJ_05627 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BMULJ_05627 (ackA)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BMULJ_05627 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: BAG47454
UniProt: A0A0H3KYF8
Position
3:complement(303024..304238)
Genome map
AA seq 404 aa AA seqDB search
MRTLALLVVNAGSSSVKFAVFAYAPHGDPARQPLHEGEAVETGNGVSIRFDAEPGGALPW
VAGDPYRAVLARIATWIRERLPHIALGAIAHRVVHGGARYVEPVIVDERVLDALRTLTPL
APLHQPHSLDAIGALRDAFPDVPQIAVFDTAFHRTLPRVEQLLPLPHAWFDAGVRRYGFH
GLSYEYLSVALDESFGARAHGRVIAAHLGSGASLCALRDGRSIATTMGFSALDGLMMSTR
CGSLDPGAVLHLLEVGKLSRDALAHLLYHESGLEGVSGTSGDPRVLLALEAAGDAHARDA
LALYVHRIVREAGALIALLGGLDMLVFTAGIGEHSAVLRERICAQLGWLGIALDAHANAV
DAHVVSSASSAIAVVVEPTNEAWIAARAALRVLRVLRGDRDSDR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgtacgctcgcgctgctcgtcgtcaacgccggttcgtcgagcgtgaagttcgcggtt
tttgcctacgcgccgcatggcgatccggcccggcagccgctgcacgaaggcgaagcggtc
gagaccggcaacggcgtgtcgatccgcttcgatgccgaaccgggcggcgcgctgccgtgg
gtcgccggcgatccataccgcgcggtgctcgcgcggatcgcgacgtggattcgcgagcgg
ctgccgcatatcgcgctcggcgcgatcgcgcatcgcgtggtgcatggcggcgcgcgttac
gtcgagccggtgatcgtcgacgaacgggtgctggatgcgctgcgcacgctcacgccgctc
gcgccgttgcatcagccgcacagcctcgacgcgatcggcgcgctgcgcgacgcgttcccc
gacgtgccgcagatcgccgtattcgacacggcgtttcaccgcacgctgccgcgcgtcgag
caacttctgccgctgccgcatgcgtggttcgacgcgggcgtgcgtcgctacggattccat
ggcctgtcgtacgaatatctttccgtcgcgctcgacgagtcgttcggcgcccgcgcgcat
ggccgcgtgatcgccgcccatctcggcagcggcgcgagcctgtgcgcgctgcgcgacggc
cgcagcatcgcgacgacgatgggattttccgcgctcgacggattgatgatgagcactcgc
tgcgggtcgctcgacccgggcgccgtgctgcacctgctggaggtcggcaagctatcgcgc
gatgcgctcgcgcacttgctctatcacgagtcggggctcgagggcgtgtcgggcacgtca
ggcgatccgcgcgtgctgctcgcgctcgaggcggccggcgacgcgcacgctcgcgacgcg
ctcgcgctgtacgtccatcggatcgtgcgcgaagcgggcgcgctgattgcgctgctcggc
ggcctcgacatgctcgtgttcacggccggcatcggcgaacactcggcggtgttgcgcgag
cggatctgcgcgcagctcggctggctcggcatcgcgctcgacgcgcacgcgaatgccgtc
gatgcgcatgtcgtgtcgtctgcatcgagcgcgatcgcggtggtcgtcgagccgaccaac
gaagcgtggatcgcggcacgggccgcgctgcgcgtgctgcgcgtgctgcgcggagaccgc
gattccgaccgttga

DBGET integrated database retrieval system