KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05898
Entry
BMULJ_05898       CDS       T00740                                 
Symbol
trbB
Name
(GenBank) type IV secretion system protein
  KO
K02283  pilus assembly protein CpaF [EC:7.4.2.8]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_05898 (trbB)
   02035 Bacterial motility proteins [BR:bmj02035]
    BMULJ_05898 (trbB)
Enzymes [BR:bmj01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     BMULJ_05898 (trbB)
Secretion system [BR:bmj02044]
 Type II secretion system
  Tight adherence (Tad) export apparatus
   BMULJ_05898 (trbB)
Bacterial motility proteins [BR:bmj02035]
 Pilus system
  Pilus assembly proteins
   BMULJ_05898 (trbB)
SSDB
Motif
Pfam: T2SSE FtsK_SpoIIIE AAA_29 AAA_7 Dynamin_N AAA_28 ABC_tran IIGP DO-GTPase1 AAA_16
Other DBs
NCBI-ProteinID: BAG47705
UniProt: A0A0H3KZ34
Position
3:complement(608983..610029)
AA seq 348 aa
MSEIAENPFLKVARLEENAVQLFFESLKLIKPYLDSPNVAEVMINSANNIWVEERGVMRR
LEIEFNPATLTGAIHSLAASVEKSAHAGTAQGIINGGHKNLRIATVMKPTAIDGDALAIR
RHRETNLSIKDYARMGAFSLVHAKRSIERPIFPPGVADEALAEAFTTMVQQRANVLVAGG
TSTGKTTFLNALNGLIPSEERVITIEDTMELKVDLPNRVRLLSNPDKGVTTQVLVALCLR
FRPDRIIVGEVRGGEAFDFIQALSTGHDGGMGSIHSNDARGGLSRLESLAMLGIPRGSRW
ELTDMRKAIADCFHYVIHLRRSGELRHVSEVLAIKGFKDGDYVLERVF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtctgaaattgccgaaaatccctttctgaaggtcgcgcgactcgaagagaacgcggta
cagctgttcttcgagtcgctgaagctcatcaagccgtacctcgattcaccaaatgtcgcc
gaagtcatgatcaactcggcgaacaacatctgggtcgaggagcggggggtgatgcgccgc
ctcgaaatcgaattcaatccggcgacgctgacaggtgccattcattcgctcgcggcctcg
gttgagaaatccgcgcacgctggtacggcccaggggattatcaacggcggccacaagaat
ctgcggatcgcaaccgtcatgaagccgacggcaatcgacggagatgcgctcgcgatccgg
cggcaccgcgagaccaatctttcgatcaaggattacgcgcgcatgggcgccttctccttg
gtccacgcgaagcgaagcattgagcggcctatcttcccacccggcgtcgcggatgaagcg
ctcgccgaggcgttcaccacgatggttcagcagcgcgccaatgtgctcgtcgccggcggt
acatcgaccggcaagactacgttcctcaacgcgctgaatggtctgattcccagtgaggag
cgggtcatcacgatcgaagacacgatggagctgaaggtcgaccttccgaaccgggtccga
cttctgtcgaaccccgacaagggcgtgacaacgcaggttctggtggcgctttgccttcgg
ttccgtcccgacagaatcatcgtcggcgaagtccgcggcggagaagcgttcgacttcatc
caggcgctcagcaccggccatgacggcggaatgggttcgattcactcgaatgatgcgcgc
ggcggcctgagccgcctcgagagcctcgcgatgttgggcatcccgcgcggcagccggtgg
gagctcaccgacatgcgcaaggcaatcgccgactgtttccactacgtcattcacctgcgc
cgatcaggggagctgcgccatgtgtcggaagtactggcgatcaagggcttcaaagacggg
gactacgttctcgaacgcgttttttaa

DBGET integrated database retrieval system