KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06137Help
Entry
BMULJ_06137       CDS       T00740                                 

Gene name
fadD
Definition
(GenBank) long-chain fatty-acid-CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00061  Fatty acid biosynthesis
bmj00071  Fatty acid degradation
bmj01100  Metabolic pathways
bmj01212  Fatty acid metabolism
bmj02024  Quorum sensing
Module
bmj_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMULJ_06137 (fadD)
   00071 Fatty acid degradation
    BMULJ_06137 (fadD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMULJ_06137 (fadD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bmj01004]
    BMULJ_06137 (fadD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmj04147]
    BMULJ_06137 (fadD)
Enzymes [BR:bmj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     BMULJ_06137 (fadD)
Lipid biosynthesis proteins [BR:bmj01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   BMULJ_06137 (fadD)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   BMULJ_06137 (fadD)
  Exosomal proteins of breast cancer cells
   BMULJ_06137 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Imm1
Motif
Other DBs
NCBI-ProteinID: BAG47936
UniProt: A0A0H3KZM3
Position
3:complement(873903..875537)
Genome map
AA seq 544 aa AA seqDB search
MTNRPWIASYGPIPAEIDADRDASVTARLGDAMRRFADRPAFRAGARTLTYADVDRLSSA
LAAYLQQVVGVRRGDRVAVMLPNVPAFPIAFVAVAKLGAVQVNVNPLYTARELEHQLNDA
GVETIVVCGGSTGTLADVIVRTRIRTVLTVGPDDLGIVPVADAARGALPTATIAFADALE
DGARRTFDAVAPNGDDLLLLQYTGGTTGLSKGAALSHRNLVANVAQFEAFMSDALRAGDE
VIVTAIPLYHIFALTVNFLSYFTAGAQNWLVANPRDVDALVDVLAAARPTVFVGVNTLYA
ALSAHPRLGNVDWSRLRLSIGGGAATIDVVSARWQAITGNFIREGYGLSETSPVVSFNPL
FVDRFTGTTGLPLPSTDVKLLDERDREAAIGEPGEICVKGPQVMTGYWQQPEANAAAFTA
DGYFRTGDIGVFDAAGFLRIVDRKKDMILVSGFNVYPNEVEAVATALPGVAECACIGMPD
ERTGEAVKLFAVLAPGATLTEADIVAHCRANLAGYKVPKCVRIVERLPKSTVGKILRREL
SRVD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacagaccctggatcgcgtcgtacggcccgattcccgcggagatcgacgccgat
cgcgatgcatcggtcacggcgaggctcggcgacgcgatgcgccgcttcgccgaccgcccc
gcgtttcgcgccggcgcgcgcacgctgacctatgcggacgtcgatcggctgtcgtccgcg
ctcgccgcgtatcttcagcaggtcgtcggcgttcgccgcggcgatcgcgtcgcggtgatg
ctgccgaacgtgcccgcgtttccgatcgcgttcgtcgccgtcgccaagctcggcgcggtg
caggtgaacgtcaacccgctctataccgcgcgcgagctcgaacatcagctcaacgacgcg
ggcgtcgagacgatcgtcgtatgcggcggatcgaccggcacgctggccgacgtgatcgta
cgcacgcggatccgcacggtgctgaccgtcgggcccgacgatctcggcatcgtgcccgtc
gccgacgcggcgcgcggcgcattgccgacggcgacgatcgcattcgccgacgcgctcgaa
gacggcgcgcgccgtacgttcgacgccgtcgcgccgaacggcgacgatctgctgctgctg
cagtacacgggcggcacgaccgggctgtcgaagggcgcggcgctgtcgcatcgcaacctc
gtcgcgaacgtcgcgcagttcgaagcgttcatgtccgacgcgctgcgcgcgggcgacgag
gtgatcgtcaccgcgatcccgctgtatcacatcttcgcgctgacggtgaacttcctgtcg
tacttcacggccggtgcgcagaactggctcgtcgcgaacccgcgcgacgtcgatgcgctg
gtcgacgtgctggccgccgcgcggccgaccgtgttcgtcggcgtgaacacgctgtatgcg
gcgctgagcgcgcatccgcggctcggcaatgtcgactggtcgcggctgcgtctctcgatc
ggcggcggtgcggcgacgatcgacgtcgtgtcggcgcgctggcaggcgatcaccggcaac
ttcatccgcgagggctacgggctgtccgagacgtcgccggtcgtgtcgttcaatccgctg
ttcgtcgatcgcttcaccggcacgacgggcctgccgttgccctcgaccgacgtgaagctg
ctcgacgagcgcgatcgcgaagcggcgatcggcgagccgggcgagatctgcgtgaagggg
ccgcaggtgatgacgggctactggcagcagccggaggcgaacgcggcggcgttcacggcc
gacggctatttccgcaccggcgatatcggcgtgttcgacgcggcgggcttcctgcgcatc
gtcgaccggaagaaggacatgatcctcgtatcgggcttcaacgtgtacccgaacgaggtc
gaagcggtcgcgaccgcgttgcccggtgtcgccgaatgcgcgtgcatcggcatgccggac
gagcgcaccggcgaggccgtgaagctgttcgcggtgctcgcgcccggtgccacgctgacc
gaggccgatatcgtcgcgcactgccgcgcgaatctcgccggctacaaggtgccgaagtgc
gtgcgcatcgtcgagcggctgccgaagtcgacggtcggcaagatcctgcgccgggaactg
tcgcgcgtcgactga

DBGET integrated database retrieval system