KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06151Help
Entry
BMULJ_06151       CDS       T00740                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00071  Fatty acid degradation
bmj00072  Synthesis and degradation of ketone bodies
bmj00280  Valine, leucine and isoleucine degradation
bmj00310  Lysine degradation
bmj00362  Benzoate degradation
bmj00380  Tryptophan metabolism
bmj00620  Pyruvate metabolism
bmj00630  Glyoxylate and dicarboxylate metabolism
bmj00640  Propanoate metabolism
bmj00650  Butanoate metabolism
bmj00900  Terpenoid backbone biosynthesis
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
bmj01212  Fatty acid metabolism
bmj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMULJ_06151 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMULJ_06151 (atoB)
   00640 Propanoate metabolism
    BMULJ_06151 (atoB)
   00650 Butanoate metabolism
    BMULJ_06151 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMULJ_06151 (atoB)
   00072 Synthesis and degradation of ketone bodies
    BMULJ_06151 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMULJ_06151 (atoB)
   00310 Lysine degradation
    BMULJ_06151 (atoB)
   00380 Tryptophan metabolism
    BMULJ_06151 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMULJ_06151 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMULJ_06151 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMULJ_06151 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmj04147]
    BMULJ_06151 (atoB)
Enzymes [BR:bmj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMULJ_06151 (atoB)
Exosome [BR:bmj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMULJ_06151 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAG47950
UniProt: A0A0H3KS85
Position
3:complement(892484..893674)
Genome map
AA seq 396 aa AA seqDB search
MTTQDPIVIVGAARTPMGGFQGDLAAASASDLGAVAIRAALERANVPAERIDEIVFGCVL
PAGQGQAPARQAALKAGLPLSAGATTVNKMCGSGMKAAMFAHDLLYADSANVAVAGGMES
MTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYEKGRLMGTFAEDCAQAYQFTREAQD
AFAIASLTRAQRAIAEGRFAAEIAPVTVKAGKTETVVSIDEQPGKAKLDKIPTLKPAFRE
GGTVTAANASSISDGAAALVMMRRSEAQRLGLTPKAVIVGHATFANKPNLFATAPIGAIR
TLSEKTGWNLRDVDLFEINEAFAVVPMAAMRDLDLPHDKVNVHGGACALGHPIGASGARV
MVTLLAALESYGLKRGVASLCIGGGEATAIAIERVA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacaggatccgatcgtaatcgtcggcgcggcgcgtacgccgatgggcggcttt
cagggcgacctggccgccgcgagcgcgagcgatctcggcgcggtagcgatccgcgcggcg
ctcgagcgcgcgaacgtgccggccgagcgcatcgacgaaatcgtgttcggctgcgtgctg
ccggcggggcagggacaggcgccggcgcgtcaggccgcattgaaggccgggctgccgctg
tcggccggcgcgacgaccgtcaacaagatgtgcggctcggggatgaaggccgcgatgttc
gcgcacgatctgctgtatgccgactcggcaaacgtcgcggtcgcgggcgggatggaaagc
atgacgaatgcgccgtatctgctgccgaaggcacgcgcgggcatgcggatggggcacggc
caggtgctcgatcacatgttcctcgacggcctcgaggatgcctatgaaaaaggccgcctg
atgggcacattcgcggaagactgcgcgcaggcctatcagttcacgcgcgaagcgcaggac
gcattcgcgatcgcgtcgctcacgcgtgcgcagcgcgcgatcgccgaaggccgcttcgcg
gccgaaatcgcgccggttacggtgaaggccggcaagacggaaaccgtcgtgtcgatcgac
gaacagccgggcaaggcgaagctcgacaagatcccgacgctgaagcccgcgttccgtgaa
ggcggcaccgtcacggccgcgaacgcgtcgtcgatctcggacggcgccgccgcgctcgtg
atgatgcgccgctccgaagcgcagcgtctcggtctcacgccgaaggccgtgatcgtcggc
catgcgacgtttgcgaacaagccgaatctgttcgcgaccgcgccgatcggcgcgattcgc
acgctatccgaaaagaccggctggaacctgcgcgacgtcgatctgttcgaaatcaacgag
gcgttcgcagtcgtcccgatggcggcgatgcgcgatctcgatctgccgcacgacaaggtc
aacgtacatggcggtgcgtgcgcgctcggtcatccgatcggcgcatcgggcgcacgcgtg
atggtgacgctgctggccgcgctcgaatcgtacgggctgaagcgcggtgtcgcgtcgctg
tgcatcggcggcggcgaggcgacggcgatcgcgatcgaacgcgtcgcgtaa

DBGET integrated database retrieval system