KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06153Help
Entry
BMULJ_06153       CDS       T00740                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00010  Glycolysis / Gluconeogenesis
bmj00620  Pyruvate metabolism
bmj00640  Propanoate metabolism
bmj00680  Methane metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_06153 (acs)
   00620 Pyruvate metabolism
    BMULJ_06153 (acs)
   00640 Propanoate metabolism
    BMULJ_06153 (acs)
  Energy metabolism
   00680 Methane metabolism
    BMULJ_06153 (acs)
Enzymes [BR:bmj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMULJ_06153 (acs)
Lipid biosynthesis proteins [BR:bmj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMULJ_06153 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAG47952
UniProt: A0A0H3KRU4
Position
3:complement(894484..896151)
Genome map
AA seq 555 aa AA seqDB search
MPDGATARAVPAYADAVARFRIDTVAAQLHGDLEHGLNACVECCDRHASGDAVALDWIDI
DGAHHRFTFAQMKALAARVANLLVERGVKPGDVVAGLLPRTPELVATILGTWRAGAVYQP
LFTAFGPKAIEHRLRMSDARLVVTNVANRAKLDEVADCPPVATVRAAEAPLPDGDIDFRA
ALDAQSDTFEPVLRKGTDLFMMMSTSGTTGLPKGVPVPLRALLAFRQYMCDAVDLRAEDR
FWNIADPGWAYGLYYAITGPLLVGHATTLYEGGFTVDSTYDVIERLGITSLAGSPTAYRM
LMAAGSDAAARIKGKLRVVSSAGEPLNPEVVRWFDAALGAPIYDHYGQTELGMVVNNHHG
LAHVVHPGSAGFAMPGYRVAVLDDAGRELGPGEPGTLAIDIARSPLLWFDGYWRQDTPAI
AGGYYRTGDNVELEPDGTVSFIGRADDVITSSGYRIGPFDVESALIEHEAVSEAAVIGVP
DPERTEIVKAFVVLSNGYEGTPALAEALSLHVKRRLSAHAYPRAIEFVDALPKTPSGKIQ
RFVLRKMEADKAAQP
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatggagcaaccgcccgggcggtgccggcgtatgccgacgccgtggcccggttc
cgaatcgacactgtcgcggcgcagttgcacggcgacctcgagcatggcctgaacgcctgc
gtcgaatgctgcgatcgtcatgcgtccggcgatgcggtcgcactcgactggatcgacatc
gacggtgcgcatcatcgcttcacgtttgctcagatgaaagcgcttgcggcgcgcgtcgcg
aacctgctggtcgagcgcggcgtgaagccgggtgacgtggtggccgggctgttgccgcgc
acgcccgaactggtcgcgacgatcctcggtacgtggcgcgcgggcgccgtctatcagccg
ttgttcacggcgttcggtccgaaggcgatcgagcaccggctgcgcatgagtgatgcgcga
ctcgtcgtgacgaacgtcgcgaaccgcgcgaagctcgacgaggttgccgattgtccgccc
gtcgcgacggtgcgcgctgccgaagcgccgctgccggacggcgacatcgacttccgtgcg
gcgctggacgcgcagtccgatacgttcgagcccgtgctgcgcaagggcaccgacctgttc
atgatgatgtcgacgtcgggcacgacgggcttgccgaaaggcgtgcccgtgccgctgcgc
gcgctgctcgcgtttcgccagtacatgtgcgacgcggtcgacctgcgcgccgaagaccgg
ttctggaacattgccgatcccggctgggcatacggactgtattacgcgatcacggggccg
ctgctggtcggccatgcgacgacgctgtacgaaggcggctttacggtcgacagcacgtac
gacgtgatcgagcggctcggcattacgagcctcgccggttcgccgacggcgtaccggatg
ctgatggcggccggctccgacgcggccgcgcgcatcaagggcaagctgcgcgtagtcagc
agcgcgggcgaaccgctgaacccggaagtcgtgcgctggttcgatgcggcgctcggcgcg
ccgatctacgatcattatggccagaccgagcttggcatggtcgtgaacaaccatcacggg
ctcgcgcacgtcgtccatcccggttccgcgggtttcgcgatgccgggctaccgcgtcgcg
gtgctcgacgacgcaggtcgcgagctcggcccgggcgagcccggcacgctcgcgatcgac
atcgcgcgttcgccgctgctgtggttcgacggatactggcggcaggacacgccggcgatc
gcaggcggctattaccgcacgggcgacaacgtcgagctcgagccggacggaaccgtcagc
ttcatcggccgcgcggacgacgtcatcacgtcgtccggctaccggatcggcccgttcgac
gtcgagagcgcgctgatcgaacatgaggcggtcagcgaggcggccgtgatcggcgtgccc
gaccccgagcgcacggagatcgtcaaggccttcgtcgtgctgtcgaacggctacgaaggc
acgccggcgctcgccgaagcgttgagtctgcacgtgaagcggcggctgtccgcgcacgcc
tatccgcgcgcgatcgagtttgtcgacgcgctgccgaaaacgccgagcggcaagatccag
cgcttcgtgctgcgcaagatggaggccgacaaggccgctcaaccctga

DBGET integrated database retrieval system