KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06195
Entry
BMULJ_06195       CDS       T00740                                 

Definition
(GenBank) hypothetical protein
  KO
K12064  conjugal transfer pilus assembly protein TraV
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Brite
KEGG Orthology (KO) [BR:bmj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmj02044]
    BMULJ_06195
Secretion system [BR:bmj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BMULJ_06195
SSDB
Motif
Pfam: TraV
Other DBs
NCBI-ProteinID: BAG47986
UniProt: A0A0H3KZV6
Position
pTGL1:22883..23572
AA seq 229 aa
MMILPAIAVSLAACSSAFNPIGSNTYDCNRKQDPTSIYCHSFRAVEASTNGRLPDSRFDT
ELKFSEYDKATDIAPPNRRDLTAPPLLTAGGQPVQLGSGGAASQPAPADATPLHAEMPVR
MGPVIQRTWIKRFVDENDMWTSDLTVLKEIAPSRWTGFDGGNPARAAGGVYPHKVADTPQ
DPSAGAVASAQSAPPAAAPPTTNDFIQPGGPAPGGENPAGIPMPMSMPQ
NT seq 690 nt   +upstreamnt  +downstreamnt
atgatgattttgccggccatcgctgtttcgctcgccgcttgctcgtccgcattcaatccg
atcgggagcaatacgtacgactgcaatcgaaagcaggatccgacgagcatctattgccat
agtttccgcgcggttgaagcttcgaccaatggtcgactgcctgatagccgcttcgatacc
gagctgaaatttagcgagtacgacaaggcaactgacatcgccccgccgaatcgtcgcgac
ttgaccgctcccccgctactgactgccggcggacaaccggtccagcttggctcgggtgga
gcggcgtcccagcctgcgccggccgatgcgacgcctctgcacgcagagatgcccgtccgt
atgggtccggtaatccagcggacctggatcaagcgtttcgtcgacgagaacgacatgtgg
acgagcgacctcaccgtgctcaaggaaatcgcgccatctcgatggacaggattcgacggt
ggcaaccccgcacgggcggccggtggcgtctatccgcacaaggttgccgacacgcctcaa
gacccgtctgctggcgcggtcgcctcggcgcaaagcgcgcctccggctgctgccccgccg
acgaccaacgatttcatccaacccggcggacccgcgccgggcggtgaaaaccccgctggc
atcccgatgccaatgtcaatgccacagtaa

DBGET integrated database retrieval system