KEGG   Burkholderia multivorans DDS 15A-1: DM80_1244Help
Entry
DM80_1244         CDS       T03292                                 

Gene name
hisE
Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00340  Histidine metabolism
bmk01100  Metabolic pathways
bmk01110  Biosynthesis of secondary metabolites
bmk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    DM80_1244 (hisE)
Enzymes [BR:bmk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     DM80_1244 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH TrbI_Ftype
Motif
Other DBs
NCBI-ProteinID: AIO77010
UniProt: B4XN80
Position
1:complement(1361718..1362083)
Genome map
AA seq 121 aa AA seqDB search
MTQSTEDTLLRLAGVIDSRKGGDPEQSYVSRLFHKGDDAVLKKIGEEATEVVLAAKDVRQ
GGAPSALVGEVADLWFHCLVMLSHFDLSPADVIAELERREGLSGIEEKALRKRREREANG
G
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaatcgaccgaagacacgctgctgcgcctcgccggcgtgatcgacagccgcaag
ggcggcgatcccgaacaatcgtacgtatcgcgcctgttccacaagggcgacgacgcagtg
ctgaagaagatcggcgaagaggcgaccgaagtcgtgctggccgcgaaggacgtgcgccag
ggcggcgcgccgtccgcgctggtcggcgaggtcgccgacctctggttccactgcctcgtg
atgctgtcgcatttcgatctgagcccggccgacgtgatcgccgagctcgagcggcgcgaa
gggctgtcggggatcgaggagaaggcgctgcgcaagcgccgcgagcgcgaggcaaacggc
ggctga

DBGET integrated database retrieval system