KEGG   Burkholderia multivorans DDS 15A-1: DM80_1443
Entry
DM80_1443         CDS       T03292                                 

Gene name
ndoB
Definition
(GenBank) naphthalene 1,2-dioxygenase subunit alpha
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00624  Polycyclic aromatic hydrocarbon degradation
bmk00626  Naphthalene degradation
bmk00627  Aminobenzoate degradation
bmk00633  Nitrotoluene degradation
bmk00642  Ethylbenzene degradation
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01220  Degradation of aromatic compounds
Module
bmk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DM80_1443 (ndoB)
   00633 Nitrotoluene degradation
    DM80_1443 (ndoB)
   00642 Ethylbenzene degradation
    DM80_1443 (ndoB)
   00626 Naphthalene degradation
    DM80_1443 (ndoB)
   00624 Polycyclic aromatic hydrocarbon degradation
    DM80_1443 (ndoB)
Enzymes [BR:bmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     DM80_1443 (ndoB)
    1.14.12.23  nitroarene dioxygenase
     DM80_1443 (ndoB)
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     DM80_1443 (ndoB)
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AIO74308
Position
1:1567520..1568863
AA seq 447 aa
MIYENLVSEAGLTQKHLIHGDKELFQHEMKTIFARNWLFLTHDSLIPSPGDYVTAKMGVD
EVIVSRQNDGSVRAFLNVCRHRGKTLVHAEAGNAKGFVCSYHGWGFGSNGELQSVPFEKE
LYGDTIKKKCLGLKEVPRIESFHGFIYGCFDAEAPTLVDYLGDAAWYLEPIFKYSGGLEL
VGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGQSIFTPLAANAMLPPEGAGLQM
TSKYGSGMGVLWDAYSGVHSADLVPEMMAFGGAKQEKLAKEIGDVRARIYRSHLNCTIFP
NNSILTCSGVFKVWNPIDENTTEVWTYAIVEKDMPEDLKRRLADAVQRTFGPAGFWESDD
NDNMETESQNAKKYQSSNSDLIANLGFGKDVYGDECYPGVVGKSAIGETSYRGFYRAYQA
HISSSNWAEFENASRNWHTELTKTTDR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgatttatgaaaatttggtgagtgaagcagggctgacgcaaaagcacctgattcatggc
gacaaagaacttttccagcacgagatgaagaccatcttcgcgcggaactggctttttctg
acccatgacagtctgattccctcccccggcgactatgtcactgccaaaatgggcgtcgat
gaagtcatcgtctcccgccagaacgatgggtcggtgcgagcctttttgaatgtttgccgt
caccggggcaagacactagttcacgctgaagccggaaatgcgaaaggctttgtgtgcagc
taccacggctggggcttcggttccaacggcgaactgcaaagcgttccctttgaaaaagag
ttgtacggcgatacgatcaaaaagaagtgcctgggcttgaaagaagtcccccgcatcgaa
agctttcatggctttatttacggttgttttgatgcagaggcccccacgcttgtcgattat
ctgggtgatgcagcctggtacttagaacccatcttcaagtactctggtggcctggaactt
gtaggcccccccggcaaagtggtgatcaaggccaactggaaggctcctgcggaaaacttt
gtgggtgacgcgtaccacgttggttggacgcacgcatcgtctttgcgctcaggtcagtcg
atatttacccctcttgcggccaacgctatgcttccacccgaaggcgcgggcttacaaatg
accagcaagtatggcagtggaatgggcgtattgtgggacgcctactccggtgtccacagc
gctgatctggttcccgaaatgatggcattcggcggcgcaaaacaggaaaaactcgccaag
gaaatcggcgatgtccgggcacggatttaccgcagccatctaaactgcacgattttcccg
aacaacagcattttgacctgctccggtgtcttcaaggtctggaacccgatcgatgaaaac
acgaccgaggtttggacgtatgccatcgtggaaaaagacatgcctgaggacttaaagcgt
cgcttggctgacgcggttcagcgcactttcggaccagcaggattctgggaaagcgacgac
aacgacaacatggagacggagtcgcaaaatgccaagaaataccaatccagcaacagtgat
ctgattgccaatttgggtttcggcaaggacgtctacggcgacgaatgctatccgggcgtc
gttggcaaatcggcaatcggcgaaaccagctatcgcggattctaccgtgcctaccaggct
cacatcagcagctccaattgggccgagttcgaaaatgcctcccgaaattggcacaccgaa
ctcaccaagacgactgatcgctaa

DBGET integrated database retrieval system