KEGG   Burkholderia multivorans DDS 15A-1: DM80_1444
Entry
DM80_1444         CDS       T03292                                 

Gene name
ndoC
Definition
(GenBank) naphthalene 1,2-dioxygenase subunit beta
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00624  Polycyclic aromatic hydrocarbon degradation
bmk00626  Naphthalene degradation
bmk00627  Aminobenzoate degradation
bmk00633  Nitrotoluene degradation
bmk00642  Ethylbenzene degradation
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01220  Degradation of aromatic compounds
Module
bmk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DM80_1444 (ndoC)
   00633 Nitrotoluene degradation
    DM80_1444 (ndoC)
   00642 Ethylbenzene degradation
    DM80_1444 (ndoC)
   00626 Naphthalene degradation
    DM80_1444 (ndoC)
   00624 Polycyclic aromatic hydrocarbon degradation
    DM80_1444 (ndoC)
Enzymes [BR:bmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     DM80_1444 (ndoC)
    1.14.12.23  nitroarene dioxygenase
     DM80_1444 (ndoC)
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     DM80_1444 (ndoC)
SSDB
Motif
Pfam: Ring_hydroxyl_B ACP_PD
Other DBs
NCBI-ProteinID: AIO76163
Position
1:1568878..1569462
AA seq 194 aa
MMINTQEDKLVSAHDAEEFHRFFVGHDSDLQQEVTTLLTREAHLLDIQAYNAWLEHCVAP
EIKYQVISRELRSTSERRYQLNDAVNIYNENYQHLKVRVEHQMDPQNWANSPKIRFTRFV
TNVTAAKDKIVPDLLHVRSNLILHRARRGNQVDVFYATREDKWKRIEGGGIKLVERLVDY
PERILQTHNLMIFL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgatgatcaatacccaggaagacaagctggtctccgcgcacgacgccgaagaatttcat
cgtttcttcgtcgggcacgacagcgatctgcagcaagaagtcaccacactcctgacccga
gaagcacatctgttggacattcaggcctacaacgcctggcttgaacactgcgttgccccc
gagatcaaataccaagtgatctcgcgagaacttcgctccacttccgagcgtcgataccaa
ctgaatgatgcggtgaacatctacaacgagaactatcagcacctgaaagttcgagttgag
catcagatggacccgcagaactgggccaacagcccgaagatccgtttcacccgcttcgtc
accaatgtcacagcggccaaggacaagatcgtaccggatctgctgcatgtgcgttccaac
ctcattctccaccgcgccagacgcggcaatcaagttgacgtcttctatgcaacgcgggaa
gacaaatggaaacgcatcgaaggtggtggcatcaaactggtggaacgtcttgtggactac
ccggagcgcattctccagacccacaatctgatgatcttcctgtga

DBGET integrated database retrieval system