KEGG   Burkholderia multivorans DDS 15A-1: DM80_1449
Entry
DM80_1449         CDS       T03292                                 

Gene name
phdJ
Definition
(GenBank) trans-2'-carboxybenzalpyruvate hydratase-aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00626  Naphthalene degradation
bmk01100  Metabolic pathways
bmk01120  Microbial metabolism in diverse environments
bmk01220  Degradation of aromatic compounds
Module
bmk_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    DM80_1449 (phdJ)
Enzymes [BR:bmk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     DM80_1449 (phdJ)
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AIO75636
Position
1:1573504..1574541
AA seq 345 aa
MTRKTSKATRLTAEDIQGAWVIMPTPSTPDASDWRSTHTVDLDETARIVEELIAAGVNGI
LSHGTFGECATLTWEEKRDFVSTVVETARGRVPYFCGTTALNTREVIRQTREVMDIGAQG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPDAAIAVYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERMTAFWSSGSMCGPATALMLRD
EVAKAKTTGDWTKAKAISDDMRAADATLFPRGDFSEFSKYNIGLEKARMDEAGWLKAGPC
RPPYTLVPDEYLAGARKSGKAWAALHTKYAEELKKTKTATGSKKK
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgacaagaaagaccagcaaagcgacgcgcctgactgcagaggatattcaaggcgcatgg
gtcattatgccgaccccctccactccggatgcttcggactggcgcagcacgcacacggtt
gatctcgacgagacggcccggatcgtcgaggagttgatagcggccggggtcaatggcatt
ctaagccacggcacttttggtgaatgcgcgacgctgacgtgggaagagaagcgggatttt
gtttcaacggtcgtcgaaaccgcccgtggtcgagtgccctacttctgcggcacaacagcc
ttgaatacccgtgaagttatacgccagacccgcgaagtgatggacattggtgcccaagga
accatgctcggcgtgccgatgtgggtgaagatggatctgcccaccgccgtgcagttttat
cgcgatgtggcggaagcggtgccagatgctgccatcgctgtttatgccaacccggaggct
ttcaaatttgattttcctcgcccgttttgggccgaaatgtccaaaatcccgcaagttgtt
acagccaagtacttgggcatcggaatgctggacttggatctgaaattggctccaaatatt
cgcttccttccgcatgaggatgactattacgctgcggcccggatcaatccggagcgcatg
actgctttctggtccagtggctccatgtgcggtccagcgaccgccctcatgctgcgtgat
gaggtggccaaggccaagacgaccggtgactggaccaaggccaaggccatttcagatgac
atgcgcgctgccgacgccacactgtttccacgcggcgatttctcggaattctcgaaatac
aacattggtctcgaaaaagcacgaatggacgaggcgggttggctcaaagcggggccgtgc
cggccaccctatacgctggtaccagatgaataccttgcaggtgctcgaaaatcaggcaag
gcttgggccgcactgcataccaagtacgccgaggaattgaagaaaaccaaaacggcaacc
ggctcgaaaaagaagtga

DBGET integrated database retrieval system