KEGG   Burkholderia multivorans DDS 15A-1: DM80_2161Help
Entry
DM80_2161         CDS       T03292                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmk  Burkholderia multivorans DDS 15A-1
Pathway
bmk00071  Fatty acid degradation
bmk00072  Synthesis and degradation of ketone bodies
bmk00280  Valine, leucine and isoleucine degradation
bmk00310  Lysine degradation
bmk00362  Benzoate degradation
bmk00380  Tryptophan metabolism
bmk00620  Pyruvate metabolism
bmk00630  Glyoxylate and dicarboxylate metabolism
bmk00640  Propanoate metabolism
bmk00650  Butanoate metabolism
bmk00900  Terpenoid backbone biosynthesis
bmk01100  Metabolic pathways
bmk01110  Biosynthesis of secondary metabolites
bmk01120  Microbial metabolism in diverse environments
bmk01130  Biosynthesis of antibiotics
bmk01200  Carbon metabolism
bmk01212  Fatty acid metabolism
bmk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM80_2161
   00630 Glyoxylate and dicarboxylate metabolism
    DM80_2161
   00640 Propanoate metabolism
    DM80_2161
   00650 Butanoate metabolism
    DM80_2161
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DM80_2161
   00072 Synthesis and degradation of ketone bodies
    DM80_2161
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DM80_2161
   00310 Lysine degradation
    DM80_2161
   00380 Tryptophan metabolism
    DM80_2161
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DM80_2161
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DM80_2161
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DM80_2161
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmk04147]
    DM80_2161
Enzymes [BR:bmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DM80_2161
Exosome [BR:bmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DM80_2161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIO75888
Position
1:2332392..2333573
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKVAAPELGATVIRAVLERAGVKPDQVSEVIMGQVLTAG
SGQNPARQSLIKAGLPSAVPGMTINKVCGSGLKAVMLAANAIVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREEQDAFAA
LSQNKAEAAQKAGRFNDEIVPVSIPQRKGEPLQFATDEFVRHGVTAESLAGLKPAFAKDG
TVTAANASGINDGAAAVLVMSAQKAQALGLTPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWTPGDLDLMEINEAFAAQALAVHKEMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMVKRDAKRGLASLCIGGGMGVALAVERD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgtagtaatcgtatcggccgcgcggaccgcggtcggcaaattcggcggctcg
ctggcgaaggtggcggcgcccgaactgggcgcgacggtgatccgcgcggtgctggagcgc
gcgggcgtgaagccggaccaggtcagcgaagtgatcatggggcaggtgctgacggcgggt
tcgggccagaacccggcgcgccagtcgctgatcaaggccggactgccgagcgcggtgccg
gggatgacgatcaacaaggtgtgcggctcggggctgaaggccgtgatgctggccgcgaac
gcgatcgtcgcgggcgacgcggagatcgtcgtggcgggcgggcaggagaacatgagcgcg
gcgccgcacgtgctgccgggctcgcgcgacgggttccggatgggcgacgcgaagctggtc
gacacgatgatcgtcgacggcctctgggacgtgtacaaccagtaccacatgggcatcacg
gcggagaacgtcgcgaaggaatacggcatcacgcgcgaagagcaggatgcgttcgcggcg
ctgtcgcagaacaaggccgaagcggcgcagaaggcggggcgcttcaatgacgagatcgtg
ccggtgtcgattccgcagcgcaagggcgagccgctgcagttcgcgaccgacgagttcgtg
cgtcatggcgtgacggcggagtcgctcgcgggcctgaagccggcgttcgcgaaggacggc
acggtgacggcggccaacgcgtcgggcatcaacgacggcgcagcggcggtgctcgtgatg
tcggcgcagaaggctcaggcgctgggcctgacgccgctcgcgcggatcaaggcctatgcg
aacgcgggcgtggacccgagcgtgatggggatgggcccggtgccggcatcgcgtcgatgc
ctggagcgcgcgggctggacgccaggcgatctggatctgatggagatcaacgaggcgttt
gcggcgcaggcgctggccgtgcacaaggagatgggctgggacacgtcgaaggtgaacgtg
aacggcggggcgatcgcgatcggtcatccgatcggcgcgtcgggctgccggatcctcgtg
acgctgctgcacgagatggtcaagcgcgatgcgaagcgcgggctcgcgtcgctctgcatc
ggcggcgggatgggcgtcgcgctggcggtcgaacgagattag

DBGET integrated database retrieval system