KEGG   Burkholderia mallei NCTC 10229: BMA10229_0029Help
Entry
BMA10229_0029     CDS       T00471                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00220  Arginine biosynthesis
bml00250  Alanine, aspartate and glutamate metabolism
bml00471  D-Glutamine and D-glutamate metabolism
bml01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMA10229_0029 (glsA)
   00220 Arginine biosynthesis
    BMA10229_0029 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BMA10229_0029 (glsA)
Enzymes [BR:bml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     BMA10229_0029 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: ABM99312
UniProt: A2RVY6
Position
II:complement(23996..24910)
Genome map
AA seq 304 aa AA seqDB search
MDYQPILERIHTELAPWIGAGRVADYIPELAKVPAERFGMAVVTLDGRIHTVGDARERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGNAFNSLVQLESERGIPRNPFINAGALIVT
DVLCRRFVGAETALVQFMRRLTGVAELDYDLRVASSELAHAERNRAMAHFMASFGNLHMP
PETVIDAYCRQCAIEMNCIELATAALFLANAGVAPVSGERILDASSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDANGNSVAGVQALEQLTTLTG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggattatcagccgattctcgaacgcatccacaccgaactcgcgccctggatcggcgcg
ggccgcgtcgccgactacatccccgaactcgcgaaagtgccggccgagcggttcggcatg
gccgtcgtcacgctcgacggccgcatccacacggtcggcgacgcgcgcgaacgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctcgcgttccagttgctcggcgatgcg
ctgtgggaacgagtcggccgagagccgtcgggcaacgcgttcaactcgctcgttcagctc
gaaagcgagcgcggcataccgcgcaatccgttcatcaatgcgggggcgctgatcgtcacc
gacgtcctgtgccgccgcttcgtcggcgccgagacggcgctcgtccagttcatgcgccgt
ctgacaggcgtcgccgagctcgactacgatctgcgcgtcgcgagctccgagctcgcccat
gccgaacgcaatcgcgcgatggcgcacttcatggcgagcttcggcaatctgcacatgccg
cccgagacggtgatcgacgcctattgccgccagtgtgcgatcgagatgaactgcatcgag
ctggcgaccgcggcgctctttctcgccaacgcgggcgttgcgcccgtatccggcgaacgc
attctcgatgccagctcggccaagcgcctgtccgccctcatgctgacatgcggcacgtac
gacgcggcaggcgatttcgtgtatcgcgtcggcctgcccgcgaaaagcggcgtgggcggc
ggcatcgtcgccgtgctgccgggcgagatggccgtgtgcgtctggtcgcccgggctcgac
gcaaacggcaactccgtcgccggcgttcaggcgctcgaacagttgaccacgctgaccggc
cggtcgattttctga

DBGET integrated database retrieval system