KEGG   Burkholderia mallei NCTC 10229: BMA10229_0715
Entry
BMA10229_0715     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_0715
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_0715
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABM99218
UniProt: A2RXW1
Position
II:752779..753273
AA seq 164 aa
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKD
DFNDVMRAQNLQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIA
LRDALKALKSPIGNIPGFRRRIQEIVADKGARKQLLDELGLDEQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgacaacgaacggatccgtcgcacccaaagagcgggtcaacatcgtctatcgcccggcg
acgggcgacgcgcaggcggaggtcgagctgccgctcaaggtgctcgtgctcggcgagttc
tcgacggccgccgacaagccgccgctcgaggagctctcgcccgtgaacgtcgacaaggac
gacttcaacgacgtgatgagggcgcagaacctccagctcgcgctcagcgtgccgaacctg
ctggacgatcaggccggcgaggacgaccggctgtccgtcacgctcggcttcgattcggtg
cacgatttctcgcccgacgcgatcgtcgagaaagtgcccgagctcaagcagctgatcgcg
ctgcgcgacgcgctgaaagcgctgaagagcccgatcggcaacattcccggctttcgcagg
cgcatccaggagatcgtcgccgacaagggcgcgcgcaagcagttgctcgacgaactcggc
ctcgacgaacaatga

DBGET integrated database retrieval system