KEGG   Burkholderia mallei NCTC 10229: BMA10229_0937Help
Entry
BMA10229_0937     CDS       T00471                                 

Gene name
apaG
Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BMA10229_0937 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABM99545
UniProt: A2RYH7
Position
II:complement(981820..982194)
Genome map
AA seq 124 aa AA seqDB search
MSQYRFSVSVKTSYLPEQSDPEHRQYAFAYTLTIRNTGQVAAQLIARHWIITDSESQVQE
VKGLGVVGHQPLLQPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFEAPVDEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatcgattcagcgtgtcggtgaagaccagctatttgccggaacaatccgac
cccgaacaccgtcaatacgcattcgcgtacacgctgacgatccgcaatacggggcaggtg
gccgcgcagttgatcgcccggcactggatcatcacggacagcgagagccaggttcaggag
gtgaaggggctcggcgtcgtcggccatcagccgttgctgcagccgggcgagcagttcgag
tacacgagctgggcggtgatcgcgacgccggtgggcacgatgcgcggcgcgtatttttgc
gtcgcggaggacggcgagcgcttcgaggcgcccgtcgacgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system