KEGG   Burkholderia mallei NCTC 10229: BMA10229_1045Help
Entry
BMA10229_1045     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_1045
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImpA_N DUF1805
Motif
Other DBs
NCBI-ProteinID: ABM99818
UniProt: A2RYT3
Position
II:complement(1094129..1095067)
Genome map
AA seq 312 aa AA seqDB search
MNNDALPGHSPDLLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKK
AKDVRVGIWHLRACIARRGLSGLADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLG
WLAGPQFLHQLGSSRFEDRDATLNDLIGGRAAAIVEDRDYRLRANTLVHGIQDSLSRIRE
SIAAAEQELNVSRVLDLLSVAASRLTQAQAGGADSASVESDAPVDAPAGASAPGAQQPMA
GPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQRMLGAGFEEVMAELYPEAAS
LVAQLSRPQSSK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgatgcactcccgggccattcgccggatttgctggatttcgacgaagacttt
atcaagatcgacgcagccatctgcgaatacgattccgtcggttacgcgccgcaacgcaaa
ggagagagtgcgttccagtgggcgtccatcgaaacgggatgtctcgctttgttgaagaag
gcgaaggatgtccgggtcggcatttggcatctgcgcgcatgcatcgcgcggcgcgggctg
agcgggctggcagacggcgttcgatcgctggccgatctgatgagtgcgcccgtcgaggaa
ttgcatcctcgcgcgctgcctgacgaatcgcccggcgaaaccctcctgattcatctcggc
tggcttgcgggcccgcagtttctgcatcagctcggcagttcccggttcgaagaccgggac
gcaaccctcaacgatctgatcggcgggcgcgccgcggcgatcgtggaggatcgcgactat
cgccttagagcgaatactcttgtacatggcattcaggattccttatcgcgaattcgggaa
tcgatcgccgcggccgagcaagagctcaacgtctcgcgcgtgctcgacctgttgagcgtc
gcggcgtctcggctcacgcaggcacaagccggcggcgcggacagcgcaagcgtcgagagc
gacgcgccggtcgatgcgccggccggcgcgtccgcgcccggcgcgcagcagccgatggcg
gggccgggcggcgtgttgaggtcgagacaggaggtcggcgcggcgctcgatcggatcgtg
gagtacttccgcgtgcacgaaccgagccatccggcgccgatcttcctgtcgcggattcaa
cgaatgctgggggcgggtttcgaggaagtgatggcggagctctatcccgaggcggcatct
ctcgtggcccaactgagccggccgcagagttccaagtaa

DBGET integrated database retrieval system