KEGG   Burkholderia mallei NCTC 10229: BMA10229_1200
Entry
BMA10229_1200     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_1200
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_1200
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABM99361
UniProt: A2RZ83
Position
II:complement(1255632..1256717)
AA seq 361 aa
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFR
LGQQPSLAFAPREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTL
GNFLDIFHHRYLTLLYRAWASAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHA
RLSASPHLVREARNADGLRMTLERYFGVPVTLEENVFHWIAVDPLEHSRLGRPGDASTMA
AGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPRLVEWVRAFVGYEFEWELELR
IKPNGAPPAVMGGPHQLGWWGWLGRSPSGEPVTGMRFEPEHYAHGFARGTARDTRGMRGE
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcgcgcgacatgacgcaggcggccgttgccgacacggcgctgtcgccgcaagcgctc
gcgcggctgcgcgccgaaccgtggcgctatgggttcctcgcgctgctgcgccgcatcggc
gcggatgcgcgcatcgatccgatcggcaaggcgaggcgcccgcaggcggagccgtttcgc
ctcggccagcagccgagcctcgcgttcgcgccgcgcgagatcgccagcgtcggcgacgcg
aacgggcggctcaaggtgcggctgttcgggctcgggatgctggggccgaacgggccgctg
ccgatccacgtgacggagatcgcgcgcgatcgcgaggagagccggcgcgatccgacgctc
ggcaattttctcgatatcttccatcatcgctatctgacgctgctgtatcgcgcgtgggcg
tcggcgcaggcggcggccggcctcgatcgtccggatgacgaacggttttcgttctacgtc
gcgagcctcgccggccaggatctcgacgaggtcggcgcgcggccgctgcccgcgcacgcg
cggctgtccgcctcgccgcatctggtgcgcgaggcgcgcaacgcggacggcctgcgaatg
acgctcgaacgttacttcggcgtgccggtgacgctggaggaaaacgtatttcactggatc
gccgtcgatccgctcgagcacagccggctcggccggcccggcgacgcatcgacgatggcc
gcgggcgcgctgctcggcgagctggtgccggatcggcagcacaagttccggctcgtgttc
gggccgctcgacatcgacgcctatctgcgcttcacgccgcggggcgaggatctgccgcgg
ctcgtcgaatgggtgcgggcgttcgtcggctacgagttcgagtgggagctcgagttgcgg
atcaagccgaacggcgcgccgcccgccgtgatgggcggcccgcatcaactcggctggtgg
ggctggctcggccgctcgccgtccggcgagccggtgacgggcatgcgtttcgaacccgag
cactatgcgcacgggttcgcgcgcggcacggctcgcgacacgcgcggcatgcgaggtgaa
cgatga

DBGET integrated database retrieval system