KEGG   Burkholderia mallei NCTC 10229: BMA10229_1211
Entry
BMA10229_1211     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bml00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10229_1211
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_1211
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_1211
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABM98644
UniProt: A2RZ93
Position
II:1267202..1267705
AA seq 167 aa
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYEL
KTDGAFNAADFFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGTLGVVAAYR
DLPNSVWRAAYPLPPARDAAWYRFSSPKLKLTIELDTHAIRITEPGK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcatccgaccacccccgttgccgccgtcgcgctcgcgctcgcgtgcgccgcgtgcgcg
agcggcgcggccaagcagaaggagccgctgcggctcgagctcgccgtgcgcgccgcgccc
acggtcaatccggacgatcggagccggccggctccgatcgtcgtgagcgtctacgagctg
aagaccgacggcgcattcaacgccgccgatttcttcacgctgcagggcccggacaagacc
gtgctcgccgacgatctgctcgcgcgcgagcgttttcaactgcgccccggcgagcgccgc
gtgatccggcgcgacgccgatccggcggcgggcacgctcggcgtggtcgccgcgtaccgc
gatctgccgaactcggtgtggcgcgcggcatatccgctgccgcccgcgcgggacgccgca
tggtatcgcttctcgtcgccgaagctgaagctgaccatcgagctcgacacgcacgcgatc
aggatcaccgaacccggaaaatga

DBGET integrated database retrieval system