KEGG   Burkholderia mallei NCTC 10229: BMA10229_1610Help
Entry
BMA10229_1610     CDS       T00471                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BMA10229_1610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bml01002]
    BMA10229_1610
Enzymes [BR:bml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     BMA10229_1610
Peptidases [BR:bml01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   BMA10229_1610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABM98770
UniProt: A2S0E1
Position
II:1660268..1660966
Genome map
AA seq 232 aa AA seqDB search
MTIEVGLLLFPQVQQLDLTGPHDVFASLPGVTVRLVWKTREPVASSSGLVLAPNATFDDC
PPLDVICVPGGIGVADLMEDADTLAFLRRHAAHARYVSSVCTGALVLGAAGLLRGRRATT
HWAFHSLLAPFGATPVRERVVRDGNLVTGGGVTAGIDFALTLAAELVGEDDAQAVQLQLE
YAPAPPFAAGDPDTAPARIVERMRERSKPVLARREQVVARAVAALERQRADG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgaagtgggattactgttgtttccgcaggtgcagcagctcgacctgaccggc
ccgcacgacgtgttcgcatcgctgcccggcgtcacggtgcggctcgtgtggaaaacgcgc
gagccggtggcgtcgagcagcgggctcgtgcttgcgccgaacgcgacgttcgacgattgc
ccgccgctcgatgtgatttgcgtgccgggcggcatcggcgtcgccgatctgatggaggat
gcggacacgctcgcgtttttgcgccggcacgcggcgcatgcgcgctacgtgagctcggtg
tgcacgggcgcgctcgtgctcggcgcggcgggactgctgcgcgggcggcgcgcgacgacg
cactgggcgttccattcgctgctcgcgccgttcggcgcgacgccggtacgcgagcgcgtc
gtgcgcgacggcaatctcgtgacgggcggcggcgtgaccgcggggatcgatttcgcgctg
acgctcgcggccgagctcgtcggcgaggacgatgcgcaggcggtgcagttgcagctcgaa
tatgcgccggccccgccgttcgcggcgggcgatccggataccgcgccggcgcggatcgtc
gagcgcatgcgcgagcggtcgaagccggtgctcgcgcggcgcgagcaggtggtcgcgcgc
gccgtggcggcgctcgagcggcagcgcgccgacgggtga

DBGET integrated database retrieval system