KEGG   Burkholderia mallei NCTC 10229: BMA10229_1784
Entry
BMA10229_1784     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06887  uncharacterized protein
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BMA10229_1784
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABM98540
UniProt: A2S0W3
Position
II:1827905..1828396
AA seq 163 aa
MGVAMFMKVDGVTGESADAQHKGWTDIQSFSWGASQPGAMASGSGGNAGKASFNDLVVAA
YMDKGATAIIKNCASGKHLPTVEISACKTGGSQIEFMRVTLQEVLVTSAQIAGVDPGDAA
DRLMMQYGFQAAKVKKQYWQQNDNGGKGAEVSVGWNIKENTEM
NT seq 492 nt   +upstreamnt  +downstreamnt
atgggcgtcgcaatgtttatgaaagtggacggcgtcaccggcgaatcggccgacgcgcag
cacaagggctggaccgacatccagtcgttctcatggggcgcgagccagccgggcgcgatg
gcgagcggcagcggcggcaacgcgggcaaggcgagcttcaacgatctcgtcgtcgccgcg
tacatggacaagggcgcaacggcgatcatcaagaactgcgcgagcggcaagcacctgccg
acggtcgagatatcggcgtgcaagacgggcggctcgcagatcgagttcatgcgcgtgacg
ctgcaggaagtgctcgtcacgtccgcgcagatcgcgggcgtggacccgggcgacgcggcc
gaccggctgatgatgcagtacggttttcaggccgcgaaggtcaagaagcagtactggcag
cagaacgacaacggcggcaagggcgccgaagtgtcggtcggctggaacatcaaggagaac
accgagatgtga

DBGET integrated database retrieval system