KEGG   Burkholderia mallei NCTC 10229: BMA10229_1785Help
Entry
BMA10229_1785     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_1785
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ABM99261
UniProt: A2S0W4
Position
II:1828415..1828975
Genome map
AA seq 186 aa AA seqDB search
MNDDVRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDL
AWLLNTRNGEDGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEP
RIAPDSVEVRSVLDAPGGAAGERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMAL
HPAAGG
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgacgtgcgagccgcgggcggcggagcgggcggcgtgcgcgccgcgcatgac
cggctgcagccggcgctgctcgaccggctgaccgacgccgagcgcgagcggcgcaccgag
ccgcccgacgcgcaggcgatcggcggcgagcgcttgcgcgcggcggtgctgcgcgatctg
gcgtggctgctcaacacgcgcaacggcgaggacggcttcgtcgactggtcggcgttcgcg
cacgcgcaggcgtcggtgctcaactacgggatgcggccgctcgtcggcaagccgatgtcg
ggcgtcgagcggatgtcggtcgaggcgtcgatccgcgatgcgatcgtgcgtttcgagccg
cgtatcgcgcccgacagcgtcgaggtgcgcagcgtgctcgacgcgccgggcggcgcggcg
ggcgagcgccggcacaacgtgctgatgttcgagatcaagggcacgctgtggtcgattccg
catccggtcgagttcgtgctgcgctcggacctcgatctggagacgggcgcgatggcgctg
cacccggcggcgggaggctga

DBGET integrated database retrieval system