KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0086Help
Entry
BMA10229_A0086    CDS       T00471                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00071  Fatty acid degradation
bml00072  Synthesis and degradation of ketone bodies
bml00280  Valine, leucine and isoleucine degradation
bml00310  Lysine degradation
bml00362  Benzoate degradation
bml00380  Tryptophan metabolism
bml00620  Pyruvate metabolism
bml00630  Glyoxylate and dicarboxylate metabolism
bml00640  Propanoate metabolism
bml00650  Butanoate metabolism
bml00900  Terpenoid backbone biosynthesis
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
bml01212  Fatty acid metabolism
bml02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMA10229_A0086 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    BMA10229_A0086 (phbA)
   00640 Propanoate metabolism
    BMA10229_A0086 (phbA)
   00650 Butanoate metabolism
    BMA10229_A0086 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMA10229_A0086 (phbA)
   00072 Synthesis and degradation of ketone bodies
    BMA10229_A0086 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMA10229_A0086 (phbA)
   00310 Lysine degradation
    BMA10229_A0086 (phbA)
   00380 Tryptophan metabolism
    BMA10229_A0086 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMA10229_A0086 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMA10229_A0086 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMA10229_A0086 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bml04147]
    BMA10229_A0086 (phbA)
Enzymes [BR:bml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMA10229_A0086 (phbA)
Exosome [BR:bml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA10229_A0086 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABN02183
UniProt: A2S2C6
Position
I:85338..86519
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKSGGSLAKIAAPELGASVIRAVLERAGVKPEQVSEVILGQVLTAG
SGQNPARQALIAAGLPNAVPGMTINKVCGSGLKAVMLAANAVVAGDAEIVVAGGQENMSA
APHVLPGSRDGFRMGDAKLVDSMIVDGLWDVYNKYHMGITAENVAKEYGITREAQDQFAA
LSQNKAEAAQKAGRFDDEIVPIEIPQRKGEPLRFATDEFVRHGVTAESLASLKPAFAKEG
TVTAANASGINDGAAAVLVMSAKKAEALGLEPLARIKAYANAGVDPSVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHKQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMLKRDAKRGLASLCIGGGMGVALALERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgcaccgcggtcggcaagtccggcggctcg
ctcgcgaagatcgccgcgccggagctcggcgcgagcgtgattcgcgcggtgctcgaacgt
gcgggcgtgaagcccgagcaggtcagcgaagtgattctgggccaggtgctgacggcgggc
tcgggccagaatccggcgcgccaggcgctgatcgcggcggggctgccgaacgcggtgccg
ggcatgacgatcaacaaggtgtgcggctccggcctgaaggccgtgatgcttgccgcgaac
gcggtcgtcgcgggcgatgcggagatcgtcgtcgcgggcggccaggagaacatgagcgcc
gcgccccacgtgctgccgggctcgcgcgacggcttccggatgggcgatgcgaagctcgtc
gacagcatgatcgtggatggcctctgggacgtctacaacaagtaccacatgggcatcacc
gcggagaacgtcgcgaaggagtacggcatcacgcgcgaggcgcaggaccagttcgccgcg
ctctcgcagaacaaggcggaagccgcgcagaaggcgggccgcttcgacgacgagatcgtg
ccgatcgagatcccgcagagaaagggcgagccgctgcgtttcgcgaccgacgagttcgtg
cgtcacggcgtgacggccgagtcgctcgcgagcctgaagcccgcgttcgcgaaggaaggc
acggtgacggccgcgaacgcgtccggcatcaacgacggcgcggccgcggtgctcgtgatg
tcggcgaagaaggccgaggcgctcggcctcgagccgctcgcgcggatcaaggcgtacgcg
aacgcgggcgtcgatccgagcgtgatgggcatgggccccgttccggcgtcgcgccgctgt
ctcgagcgcgcgggctggtcggtgggcgacctcgacctgatggagatcaacgaggcgttc
gccgcgcaggcgctcgcggttcacaagcagatgggctgggatacgtcgaaggtcaacgtg
aatggcggcgcgatcgcgatcggccatccgatcggcgcgtcgggctgccggattctcgtc
acgctgctgcacgaaatgctcaagcgcgatgcgaaacgcggcctcgcatcgctttgcatc
ggcggcgggatgggcgtcgcgctcgcgctcgagcgtccgtaa

DBGET integrated database retrieval system