KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0467Help
Entry
BMA10229_A0467    CDS       T00471                                 

Definition
(GenBank) alcohol dehydrogenase, short-chain family
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00061  Fatty acid biosynthesis
bml00650  Butanoate metabolism
bml01100  Metabolic pathways
bml01120  Microbial metabolism in diverse environments
bml01200  Carbon metabolism
bml01212  Fatty acid metabolism
Module
bml_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BMA10229_A0467
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BMA10229_A0467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bml01004]
    BMA10229_A0467
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BMA10229_A0467
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     BMA10229_A0467
Lipid biosynthesis proteins [BR:bml01004]
 Fatty acid synthase
  Component type
   BMA10229_A0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: ABN02540
UniProt: A2S3E6
Position
I:491947..493140
Genome map
AA seq 397 aa AA seqDB search
MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIA
AAFGVGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSVNGDAFSDEIKHK
TIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETL
LQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSI
GEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARST
HEGCIEQVDGLLRDSLYSAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYTLT
DFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtacgcggcttcatctgcgtcaccacccaccccgccggctgc
gcggcgagcgttcgcgagcagatcgcgtacgtcgcccgccgcggcccgatcgagcgcggc
ccgaagaaggtgctcgtgatcggcgcgtcgacgggctacgggctcgccgcgcgcatcgcc
gccgcgttcggcgtgggcgcggcgacgctcggggtgttcttcgagcgcgcgccggcggac
gcgaagcccggcacggccggctggtacaacagcgcggcgttccacgacgaagcggccgcg
cgcggcctccaggcgacgagcgtcaacggcgacgcgttctccgacgagatcaagcacaag
acgatcgatgcgatccggcgcgatctcgggcaggtggaccttgtcgtctacagcgtcgcc
gcgccgcgcaggacgcatccgaaaacgggcgtcacgcatcagtccacgttgaagccgatc
ggccacgcggtgcggctgcgcggcatcgatacggacaacgaggcgatcaaggaaacgctg
ctgcagccggccacgcccgacgagatcgcggacacggtcgccgtgatgggcggcgaggac
tggcgcatgtggatcgacgcgctcgatgcggcgggagtgcttgccgacggcgcgaagacg
accgcgttcacgtatctgggcgagcaggtcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgaccgcaccgtgctcgcgctgcgcggcaagctcgccgcg
cgcggcggcgacgcgcgcgtctcggtgctgaaggcggtcgtcacgcaggcgagctccgcg
atcccgatgatgccgctctacctgtcgctgctcttcaaggtgatgaaggcgcgcagcacg
catgaaggctgcatcgagcaggtcgacggcctgttgcgcgacagcctgtacagcgcgcag
ccgcacgtcgacgccgaaggccggctgcgcgcggaccgcctcgagctcgatccggccgtg
caggcgcgcgtgctcgagctgtgggaccaggtgacggacgacaatctgtatacgctcacc
gatttcgccggctacaaggccgaattcctgcgcctgttcggcttcgggatcgacggcgtc
gattacgatgcgcctgtcgagccgaacgtacggattccgaatctgatcgaatga

DBGET integrated database retrieval system