KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0498
Entry
BMA10229_A0498    CDS       T00471                                 

Definition
(GenBank) Rhs element Vgr protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: ABN00716
UniProt: A2S3H7
Position
I:complement(518772..521579)
AA seq 935 aa
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLD
AMLGQRVTIRTALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTF
VRQGVADVLGAVFAPYGAIARWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEA
GLGFCFVEEADAPAGHTMLIFDDSTQLPEDETSARMGGVPQRLSGTATEPDDVIVGIGQS
LSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDVGPEAFDSLREADAAARRHAD
AIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVDQIGINNLPAT
VMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGH
GLQQTPRIGHEVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESVYAQAS
DHAASAQGNLAGGHSPAWHGAGGGAKRHDHAGALSGFKSQEFDGQGYNQLVADDTDRMGR
MQMATTHAATQLNIGHLRHQADNYLGSFRGQGVELRSDAYGALRGARGVLISSYAPTGPS
QPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRGAQRAGQSSMNGDAAPLDALG
KSFATTVGADGYAQASADASRRATGNALPHTGDAVLGVEAKGGQGLLAGQSLQWAAGETL
TIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVG
PDQLAPALPQFPEKVCVECLKHAMQSGSALAGKAI
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgagcgtgatcacgcaattcacgtcgcttttcagcgctgccaattgtctctattgtctc
gacggtccgggcgaaatcgcgtcgctgcagatcgagcgctgggtggggcgggagacgctc
tccgagaacttccagtgggatgtctacgcgctcgcgaccgatcccggcctcgacctcgac
gcgatgctcgggcagcgcgtgacgatccgcacggcgctcgcgaacggcacgagcgccgtg
cgcagcgggctcgtggcgcaggccgagtgcatcggctacgacgccggcctcgcgcgctac
tgcctgcagctcgtgccgtggctcgccgcgctcgcgcacggccgcgacgagcgcacgttc
gtgcggcagggcgtcgccgacgtgctcggcgcggtgttcgcgccgtacggcgcgatcgcc
cgctggcgcttcaccgcggacgcgaaccagcgcatcgcggaactcggcgcgcgcgactac
cgcgtgcagtaccgcacccacacgcatttcgatttcgtccggcacgtgcttgccgaagcg
ggtctcggcttttgcttcgtcgaggaggcggacgcgcccgcgggccacacgatgctgatc
ttcgacgacagcacgcagttgcccgaggacgagacttccgcgcgcatgggcggcgtgccg
cagcggctgagcggcacggcgaccgagccggacgacgtgatcgtcggcatcgggcagtcg
ctgtcgctgaccgcggatcgcgtcacgctgatcagcagcgactaccgcggcaaccagtcg
acgagcgcgacggcgagcctcggcaatccggccggatcgcgcgagctgtacgacgacgtc
gggccggaggcgttcgacagcctgcgcgaggccgacgccgccgcgcggcggcacgcggac
gcgatcgtctcggcggcgcgcttctggacaggctacggcacgttgcgcaccgcgcgcgct
ggccgcgcgctgcgcatcgcgggcgcgacgtggcgcatgtcgcgcggcggcgcgccggcg
cccgatgcgttcgtgttgacgcgcgtcgatcagatcggcatcaacaatttgcccgcgacg
gtgatggagcgcgtcgagcgcagcctcggcccgctgccgcccgcgaatctcgacgcgcgc
gtgctcgcgcaggcgaaggcgggcggctatgcgaaccggttcgacgccgcgccgcgcgac
caggcatggcgcccgacgctggaggacggcaccggccagcgactgaacccggtgccgacg
gcgctcggcgcgcagacggcgatcgtcgtcgggccgcagggcgagacgcggccgggctcg
acgggcccggtgcataccgacgcgcagggccggttgcggctgcgctatcactggcaggcg
gacggcgacgcgggcacctatccgacgcgcgcgatgcagcggctcgcgagcgaggggcac
gggctgcagcagacgccgcggatcggccacgaggtgctcgtgcagttcgtcaacggcctc
gtgcaccggccgatcgtgctcggcgggctgttcaacggccgcggcgagggcggcgaagcg
ccgacgcccggcggcgaagcggggcagccgctcgacgaatcggtctacgcacaggcgagc
gaccacgcggcgagcgcgcaaggcaatcttgcgggcggccatagccccgcgtggcacggc
gcgggcggcggcgcgaagcgccacgatcacgcgggcgcgctgtccggcttcaagagccag
gagttcgacggccagggctacaaccagctcgtcgcggacgataccgatcgcatgggccgc
atgcagatggcgacgacgcacgcggcgacccagctcaatatcggccatttgcggcatcag
gccgacaactatctcggcagcttccgcgggcaaggcgtcgagctgcgctcggacgcgtac
ggcgcgctgcgcggcgcgcgcggcgtgctgatctccagctatgcgccgacggggccgtcg
cagccggcgggcgatgcgtcggcgctgcagtcgctgctcgcgcaacaggcggcgctcgcg
aagcttctcgacaaatcggcggacacgcacaagaccttgccgttcgccgcgcagcgtggc
gcgcagcgggccggacagtcgtcgatgaacggcgacgccgcgccgctcgacgcgctcggg
aagagtttcgcgacgacggtcggcgccgacggctacgcgcaggcgtcggccgacgcatcg
cgccgcgcgacgggcaatgcgctgccgcataccggcgacgcggtgctcggcgtcgaggcg
aagggcggccaggggctgctggccggccagtcgctgcaatgggcggcgggcgagacgctg
accatcggcagcggcaacgacaccaacctcgcggtcaaccggacgttgcgcgtgcacagc
gggcagggcatcggctggcttgccggcgcgaacggcgcgaacggcgcgcagggcgtcggc
atgagcgtgatcgccggcaaggacgatctggcgctgcaggcgcagcacgacctgatggcg
ctgcgcgcgcgcgacgatctgagggtcgcgtcgatcggcgcggacgtcgagatcgcggcg
aagcagaccgtgcggctcgcggtcagcggcggcgcgcatctgacgatcgaaggcggcaac
gtcacgttcggctgcccgggctcgctcgtcgttcatgcggcccagcatacgttcgtcggg
ccggatcaactggctcccgcgctgccgcagtttcccgagaaggtgtgcgtcgaatgcctg
aagcacgcgatgcaatcgggcagcgcactggccggcaaggcgatctga

DBGET integrated database retrieval system