KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1710
Entry
BMA10229_A1710    CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_A1710
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_A1710
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABN02195
UniProt: A2S6X1
Position
I:1751068..1751550
AA seq 160 aa
MKRFEPSFLDKLFDDEPHVPAPAAMRQLSLEELKNTVARDVEAILNTRIALTEEDLAELP
ECQRSVLTYGLNDFAGLSLASHYDRTFICKSIQQAIARHEPRLQQVQVAFELNEQSTNAL
YFAIQALLVVHPAEEPVTFDAMLQPSTLQYSVTRSRAAKV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaaacgtttcgaaccgagcttcctcgacaagctgttcgacgacgaaccgcacgtgccg
gcgcccgccgcgatgcggcagttgtcgttggaggagctgaagaacacggtcgcgcgcgac
gtcgaggcgatcctcaacacgcgcatcgcgctgaccgaagaagatctcgccgagctgccc
gaatgccagcgctcggtgctgacctacgggctgaacgatttcgccggcctgagcctcgcg
agccactacgatcgcacgttcatctgcaaatcgattcagcaggcgatcgcgcggcacgag
ccgaggctgcagcaggtgcaggtggcgttcgagctgaacgagcagtcgacgaacgcgctc
tatttcgcgatccaggcgctgctcgtcgtgcatcctgccgaggaaccggtgaccttcgat
gcgatgctgcagccgtcgacgttgcaatattcggtgacgcgttcgcgcgccgccaaggtg
tga

DBGET integrated database retrieval system