KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1713
Entry
BMA10229_A1713    CDS       T00471                                 

Definition
(GenBank) ClpA/B type protease
  KO
K11907  type VI secretion system protein VasG
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bml00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10229_A1713
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bml02044]
    BMA10229_A1713
Secretion system [BR:bml02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10229_A1713
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA Clp_N AAA_5 ClpB_D2-small AAA_16 Sigma54_activat AAA_7 TniB AAA_30 NACHT T2SSE SRP54 AAA_23 Zeta_toxin ABC_tran_CTD
Other DBs
NCBI-ProteinID: ABN01916
UniProt: A2S6X4
Position
I:1754566..1757235
AA seq 889 aa
MSTPLKTLIAKLNPVCRKATERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASG
VDPHALRADLERELERLKTGNTRTPVFSVHLSELFEQAWLIASLDSQIGRIRSGHLLLAL
LTGPDLAQFAQRMSSQFARVRVDDLKHKFDEIAAGSSEAEPRHADADVAVPDGAAASGDA
PRGPSKTPALDTYTTNLTQRAREGKIDPVIGRDAEIRQAIDILMRRRQNNPIMTGEAGVG
KTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASVKGEFENRLKSVIDEVKKSAH
PIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKYFEKDAALAR
RFQVVKIEEPSEPLAAAMLRGMAALMERHFNVRVLDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSSTPAAIDDAKKRIERIDAEIAALEREAASGAAHDARLAELREARD
ADLKALAEDAARYEEERALVTEIGALRAELDAARESSADGKPVDVDATRAKLAERVDALR
ARQGNQPMVPLQVDGHVVAEIVASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALG
AIAQRVRTATANLEDPNKPRGVFMFVGPSGVGKTETALALADVLYGGERKLITINMSEYQ
EAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGA
MDDAEGREIDFRNTLIILTSNVGSSAVMQACLNKAPQELPDAETLAETLRPQLYKTFKPA
FLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAELVLSRIADGEAIVRIAARAAETGEFEYTVE
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgagcacgcccctgaagaccctgatcgcgaaactgaacccggtgtgccgcaaggccacc
gagcgcgccgccagccactgcttcgcgcgcggtcactacgaagtggatctcgagcatctg
tttctcgcgctgctcgacgagtcgaccggcgacgtgccgctcgtgctgcgcgcgagcggc
gtcgatccgcacgcgctgcgcgcggatctcgagcgcgagctcgaaagactgaaaacgggc
aacacgcgcacgccggtgttttcggtgcatctgagcgagctgttcgagcaggcgtggctc
atcgcgtcgctcgattcgcagatcggacggatccgctcggggcacctgctgctcgcgctg
ctgaccgggccggacctcgcgcagttcgcgcagcggatgtcgtcgcagttcgcgcgcgtg
cgcgtcgatgacctgaagcacaagttcgacgagatcgccgcgggttcgagcgaggccgag
ccgcggcacgcggacgccgatgtcgcggtgcccgacggcgccgccgcttcgggcgatgcg
ccgcgcggcccgtcgaagacgccggcgctcgacacgtacacgacgaacctcacgcagcgc
gcgcgcgagggcaagatcgacccggtgatcggccgcgatgcggagatccgccaggcgatc
gacatcctgatgcgccgccggcagaacaatccgatcatgacgggcgaggcgggcgtgggc
aagacggccgtcgtcgaagggctcgcgctgcgcatcgcggccgacgacgtgccgccgccg
cttcgcggcgtcgcgctgcacgtgctggacatgggcctcctgcaggcgggcgcgagcgtg
aagggcgagttcgagaatcgcctgaagagcgtgatcgacgaggtgaaaaagagcgcgcat
ccgatcattctcttcatcgacgaggcgcacacgatcatcggcgcgggcgggcaggcgggc
cagaacgatgcggcgaacctgctgaagccggcgctcgcgcgcggcgagctgcgcacgatc
gcggcgacgacgtggagcgagtacaagaagtatttcgaaaaggacgcggcgcttgcgcgg
cgcttccaggtggtgaagatcgaggagccgagcgagccgctcgccgccgcgatgctgcgc
gggatggcggcgctgatggagcggcacttcaacgtgcgcgttctcgacgacgcgatcacc
gaggcggtgcggctgtcgcatcgctatatcagcggccgccagttgccggacaaggcgatc
agcgtgctcgacaccgcctgcgcgaaggtcgcgctcgcgcacagctcgacgcccgcggcg
atcgacgacgcgaaaaaacgcatcgagcggatcgacgcggaaatcgcggcactcgagcgc
gaggccgcgagcggcgccgcgcacgatgcgcgcctcgccgaactgcgcgaggcccgcgac
gccgatctgaaggcgctggccgaggacgccgcgcgctacgaggaggagcgcgcgctcgtg
accgaaatcggcgcgctgcgcgccgagctcgatgccgcacgcgagtcgtccgccgacggc
aagcccgtcgatgtcgacgcgacgcgcgcgaagcttgccgagcgcgtcgatgcgttgcgc
gcgcggcagggcaaccagccgatggtgccgttgcaggtcgacggccacgtcgtcgcggag
atcgtcgcgtcgtggacgggcattccgctcggcaggatggtgaaggacgagatcgagacc
gtgctgaacctgcgcgatctgctcggcgcgcgcgtgatcggccaggaccatgcgctcggc
gcgatcgcgcagcgcgtgcgcaccgcgaccgcgaacctcgaggatccgaacaagccgcgc
ggcgtgttcatgttcgtcgggccgtcgggcgtcggcaagaccgagaccgcgctcgcgctc
gccgacgtgctgtacggcggcgagcgcaagctgatcacgatcaacatgagcgagtatcag
gaggcgcacagcgtgtcgggcctgaagggctcgccgcccggctacgtcggctacggcgag
ggcggcgtgctgacggaggcggtgcgtcgcaatccgtattcggtcgtgttgctcgacgaa
gtcgagaaggcgcatccggacgtgctcgagatgttcttccaggtgttcgacaagggcgcg
atggacgatgccgaaggccgtgagatcgactttcgcaacacgctgatcatcctgacctcg
aacgtcggctcgtcggcggtgatgcaggcgtgcctgaacaaggcgccgcaggagctgccc
gatgccgagacgcttgccgagacgctgcgcccgcagctctacaagaccttcaagcccgcg
ttcctcggccggatgaaggtgattccgtactatccgatctccgacgacgtgctcgccgag
atcatcgagctgaagctcgaacggattcgccgccggatcgaagcgaaccacaaggcggcg
ttcgagtgggacgagtcgctcgtcgatgccgtgctcgcgcgctgcaccgaagtcgattcg
ggcgcgcgcaacgtcgatcacatcctgaacggcacgctgctgccggagatcgccgagctc
gtgctgtcgcgcatcgccgatggcgaggcgatcgtgcggatcgccgcgcgcgcggccgag
acgggcgaattcgagtacacggtcgagtaa

DBGET integrated database retrieval system