KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1715
Entry
BMA10229_A1715    CDS       T00471                                 

Definition
(GenBank) ompA family protein
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bml02000]
    BMA10229_A1715
Transporters [BR:bml02000]
 Other transporters
  Pores ion channels [TC:1]
   BMA10229_A1715
SSDB
Motif
Pfam: OmpA Pilus_CpaD BON FinO_N
Other DBs
NCBI-ProteinID: ABN03345
UniProt: A2S6X6
Position
I:complement(1758645..1759577)
AA seq 310 aa
MTKPRLPLLRACRFALALAALALGGAARADNVGPATVTPIDAGGVPVKSVPLAAPVTAAP
VAATAGAGATVSSPPPANATPGQVVAGGKVADEATKAAVLQRLRDTYGAANVVDQIEIGN
VATPPNWSANVQKLIGPQLKQISKGQLKIDGTQIDVKGEVHNEAQRQQLASDMANALNPT
YTIKNGLRVSASEQGLLDQTLANRTIEFETGSATLTPQGRAILDQMAGALAKMSSRTVEI
IGHTDNSGNRTSNIALSQARADAVKGYLVTKGIASQQLTTTGVGPDQPIAPNDSADGRAR
NRRIEFRAGQ
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacgaagccccgcctgcccctgctgcgcgcctgccgcttcgcgctcgcgctcgccgcg
ctcgcgctcggcggcgccgcgcgcgccgacaacgtcggccccgccaccgtcacgccgatc
gacgcaggcggcgtgcccgtgaaatcggtgccgctcgccgcgcccgtgacggccgcgccg
gtcgccgcgacggccggcgcgggcgcgaccgtgtcgtcgccgccgcccgcgaacgcgacg
ccgggccaggtcgtcgccggcggcaaggtcgccgacgaagcgacgaaggccgccgtgctg
cagcgcctgcgcgacacgtacggcgccgcgaacgtcgtcgaccagatcgaaatcggcaac
gtcgcgacgccgccgaactggtccgcgaacgtccagaagctgatcggcccgcaactgaaa
cagatcagcaaaggacagctgaagatcgacggcacgcagatcgacgtgaagggcgaagtg
cacaacgaggcgcagcgccagcagctcgcgagcgacatggcgaacgcgctgaatccgacc
tacacgatcaagaacgggctgcgcgtgagcgcgtccgagcagggcctgctcgaccagacg
ctcgcgaaccgcacgatcgaattcgaaaccggcagcgcgacgctcacgccgcaaggccgc
gcgattctcgaccagatggcgggcgcgctcgcgaagatgtcgagccgaacggtcgagatc
atcgggcacaccgacaactcgggcaaccgcacgtcgaacatcgcgctcagccaggcgcgc
gcggacgcggtcaagggatatctggtgacgaagggcatcgcgtcgcagcaactgacgacg
acgggcgtcggccccgatcagccgatcgcgccgaacgattcggccgacgggcgcgcgcgc
aatcgccggatcgaattccgcgcgggacagtaa

DBGET integrated database retrieval system