KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2550Help
Entry
BMA10229_A2550    CDS       T00471                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase family protein
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00010  Glycolysis / Gluconeogenesis
bml00030  Pentose phosphate pathway
bml00051  Fructose and mannose metabolism
bml00052  Galactose metabolism
bml00230  Purine metabolism
bml00500  Starch and sucrose metabolism
bml00520  Amino sugar and nucleotide sugar metabolism
bml00521  Streptomycin biosynthesis
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A2550
   00030 Pentose phosphate pathway
    BMA10229_A2550
   00051 Fructose and mannose metabolism
    BMA10229_A2550
   00052 Galactose metabolism
    BMA10229_A2550
   00500 Starch and sucrose metabolism
    BMA10229_A2550
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10229_A2550
  Nucleotide metabolism
   00230 Purine metabolism
    BMA10229_A2550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMA10229_A2550
Enzymes [BR:bml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BMA10229_A2550
    5.4.2.8  phosphomannomutase
     BMA10229_A2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABN01807
UniProt: A2S989
Position
I:2595274..2596668
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGDQIQGLYKRIVDARFETGNGSYERYDVADQYVERIVGDIRLARPLKLVVDA
GNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKTTDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLAQWVREKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARAADP
SALLNGLPNAVSTPELQLKLDEGENVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEASSDAALVRIQDDFRRALKAAKPDANLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctc
gacgccgacgtcgcacgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccggctctcgggccccgagctcgtcggcgcg
ctcgcggacgggctgcgcgcggcgggcgtcgatgtcgtcgacgtcggcatggtgccgacg
cccgtcggctacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtc
gattcgtgcatcgtcgtcacgggcagccacaatccgcccgactacaacggtttcaagatg
gtcctgcgcggcgccgcgatttacggcgaccagatccagggcctgtacaagcgcatcgtc
gacgcgcgtttcgagaccggcaacggttcgtatgagcgatacgatgtcgccgatcaatac
gtcgagcgcatcgtcggcgacatcaggctcgcgcggccgctgaagctcgtcgtcgatgcg
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgaactc
gtcgagctcttcaccgacatcgacggcaacttcccgaaccaccacccggacccggcgcac
ccggagaacctgcaggacgtgatcgcgaagctgaagacgaccgatgccgagatcggcttc
gcgttcgacggcgacggcgaccgcctcggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgccgaggaagtgctgtcgcgcaacccgggcgcgcag
atcatctacgacgtgaagtgcacgcgcaatctcgcgcagtgggtgcgcgagaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgagacgggc
gcgccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggcctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgcagccgatccg
agcgcgctgctcaacggcttgccgaacgcggtgtcgacgcccgagctgcaactgaagctc
gacgaaggcgagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggc
gcggacgaggtcgtgacgatcgacggtctgcgcgtcgagtatccggacggcttcggtctc
gcgcgttcgtcgaacacgacgcccgtggtcgtgctgcgcttcgaggcgagctccgacgcg
gcgctcgtgcggatccaggacgatttccggcgcgcgctgaaggcggcgaagccggacgcg
aacctgccgttctga

DBGET integrated database retrieval system