KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2945Help
Entry
BMA10229_A2945    CDS       T00471                                 

Definition
(GenBank) putative membrane protein
  KO
K07091  lipopolysaccharide export system permease protein
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bml00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMA10229_A2945
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bml02000]
    BMA10229_A2945
Transporters [BR:bml02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    BMA10229_A2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG Yip1
Motif
Other DBs
NCBI-ProteinID: ABN01276
UniProt: A2SAC0
Position
I:complement(2967285..2968382)
Genome map
AA seq 365 aa AA seqDB search
MIFERSLQRELAYTAGAVFMVLLTIMLTSMMIRIVGYAASGEVNPKDVLVLIGLTVIGYL
AMILVGTLFVSILFVLTRWYKDSEMVVWLASGVSLTRLIKPIGVFATPIVILIAFFAFVG
WPWSNQQSKLIKARFQQRDEVSLLAPGQFRESAANHRVFFIEKMSPDQAKVQNVFVTTTE
HGKVNVVVSQTGHTETMKNGDRFIVLENGRRYDGVPGQPNFKIMEFERYGVKIQSKQIVS
QPTTTGTSTPDLLRNPTNQNLAEFAWRAGLPLIAINLMILAIPLAYQNPRRGRTVNLVMA
VLIYLTYSNLLNVVQSQMERGKIAFGLGLIGLHVIVAGIVALLFWLRVRNRPLFSRAAAG
RSQGA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgaacgctccctccagcgcgagcttgcgtacaccgccggcgccgtcttcatg
gtgctgctcacgatcatgctgacgtcgatgatgattcgcatcgtcggctacgccgcgtcc
ggcgaggtgaatccgaaggacgtgctggtcctgatcggcctcaccgtgatcggctatctc
gcgatgattctcgtcggcacgctgttcgtgtcgatcctgttcgtgctcacgcgctggtac
aaggattccgagatggtcgtctggctcgcgtccggcgtgagcctcacgcggctcatcaag
ccgatcggcgtgttcgcgacgccgatcgtgatcctgatcgccttcttcgcgttcgtcggc
tggccgtggtcgaaccagcagagcaagctcatcaaggcgcgcttccagcagcgcgacgag
gtgtcgttgctcgcgcccggccagttccgcgagtccgcggcgaaccaccgcgtgttcttc
atcgagaagatgtcgcctgatcaggcgaaggtgcagaacgtgttcgtcacgacgaccgag
cacggcaaggtgaacgtcgtcgtgtcgcagacgggccataccgagacgatgaagaacggc
gaccgcttcatcgtgctcgagaacggccgccgctacgacggcgtgcccggccagccgaac
ttcaagatcatggagttcgagcgctacggtgtgaagatccagagcaagcagatcgtgagc
cagccgacgaccaccggcacgtcgacgcccgacctgctgcgcaacccgaccaaccagaac
ctcgccgaattcgcgtggcgcgccgggctgccgctcatcgcgatcaacctgatgatcctc
gcgatcccgctcgcgtatcagaacccgcgccgcgggcggaccgtgaacctcgtgatggcc
gtgctgatctacctcacctattcgaatctgctgaacgtcgtccagtcgcaaatggaacgg
ggcaagattgcgttcgggctcgggctcatcgggctgcacgtaatcgtcgccggcatcgtc
gcgctcctgttctggctgcgcgtgcgcaaccggcccctcttctcgcgcgccgcggccggc
cgctcgcagggggcctga

DBGET integrated database retrieval system