KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3006Help
Entry
BMA10229_A3006    CDS       T00471                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00010  Glycolysis / Gluconeogenesis
bml00053  Ascorbate and aldarate metabolism
bml00071  Fatty acid degradation
bml00280  Valine, leucine and isoleucine degradation
bml00310  Lysine degradation
bml00330  Arginine and proline metabolism
bml00340  Histidine metabolism
bml00380  Tryptophan metabolism
bml00410  beta-Alanine metabolism
bml00561  Glycerolipid metabolism
bml00620  Pyruvate metabolism
bml00625  Chloroalkane and chloroalkene degradation
bml00903  Limonene and pinene degradation
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A3006
   00053 Ascorbate and aldarate metabolism
    BMA10229_A3006
   00620 Pyruvate metabolism
    BMA10229_A3006
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMA10229_A3006
   00561 Glycerolipid metabolism
    BMA10229_A3006
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMA10229_A3006
   00310 Lysine degradation
    BMA10229_A3006
   00330 Arginine and proline metabolism
    BMA10229_A3006
   00340 Histidine metabolism
    BMA10229_A3006
   00380 Tryptophan metabolism
    BMA10229_A3006
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMA10229_A3006
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMA10229_A3006
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMA10229_A3006
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BMA10229_A3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LPD7 DUF1487
Motif
Other DBs
NCBI-ProteinID: ABN01858
UniProt: A2SAI1
Position
I:complement(3037748..3039187)
Genome map
AA seq 479 aa AA seqDB search
MEEAKHFIAGAWAPPAGGETIAVIDPSDGEPFARLARGTAPDVGAAVQAARAAFDGSWGA
LGAADRGRMLYRLSMLVAACREELALIESRDTGKPLTQARADADALARYLEFYAGAADKL
HGETLPYRDGYTVLTLREPHGVTGHIVPWNYPMQILGRSVGAALAAGNACVVKPSEDACL
SILRVATLAAEAGLPEGAFNVVTGYGHEAGAALARHPGVDHLSFTGSPDTGRLVAQMAAE
HHASVTLELGGKSPQIVFADADLDAALPVLVSAIVQNAGQTCSAGSRVLIDKAVYEPLVE
RLATAFNGLKVGPGRADLDCGPLINAKQQQRVWDFLSDAQHDGITMAAHGQVVPDAPETG
FYQAPALLRDVPHTHRLAQEEVFGPVLAAMPFADEDEALALANGTPFGLVAGIWTRDGAR
QMRLARKVRAGQVFVNNYGAGGGVELPFGGTGRSGYGREKGFEALYGFTVLKTIALRHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgaagcacttcatcgcgggcgcatgggcgccgcccgcgggcggcgagacg
atcgccgtgatcgacccgtccgacggcgagccgttcgcgcggctcgcgcgcggcaccgcg
cccgatgtcggcgcggccgtgcaagcggcgcgcgccgcgttcgacggctcgtggggcgcg
ctcggcgcggccgaccgcgggcgcatgctgtaccggctgtcgatgctcgtcgccgcgtgc
cgcgaggagctcgcgctcatcgaatcgcgcgacaccggcaagccgctcacgcaggcgcgc
gcggacgccgacgcgctcgcccgctacctcgagttctacgcgggcgcggccgacaagctg
cacggcgagacgctgccctaccgcgacggctacacggtactcacgctgcgcgagccgcac
ggcgtgacgggccacatcgtgccgtggaattatccgatgcagatcctcgggcgcagcgtc
ggcgcggcgctcgccgcgggcaacgcgtgcgtcgtcaagccctcggaggacgcgtgcctg
tcgatcctgcgcgtcgccacgctcgccgccgaagccgggctgcccgagggcgcgttcaac
gtcgtgacgggctacggccacgaagcgggcgcggcgctcgcgcgccatcccggcgtcgat
cacctgtcgttcaccggttcgccggatacaggccgcctcgtcgcgcagatggcggccgag
caccacgcgagcgtcacgctcgagctcggcggcaagtcgccgcagatcgtgttcgccgac
gcggatctcgacgcggcattgcccgtcctcgtgtccgcgatcgtccagaacgccggccag
acctgttcggccggcagccgcgtgctgatcgacaaggcggtctacgagccgctcgtcgag
cggctcgcgaccgcgttcaacgggctgaaggtcggccccggccgcgccgatctcgattgc
gggccgctcatcaacgcgaagcagcagcagcgcgtgtgggacttcctctccgatgcgcag
cacgacggcatcacgatggccgcgcacggccaggtcgtgccggacgcgcccgaaacgggc
ttctaccaggcgcccgcgctgcttcgcgacgtgccgcacacgcaccggctcgcacaggag
gaagtgttcgggccggtgctcgccgcgatgccgttcgccgacgaggacgaagcgctcgcg
ctcgcgaacggcacgccgttcgggctcgtcgccggcatctggacgcgcgacggcgcgcgg
cagatgcggctcgcgcgcaaggtgcgcgcggggcaggtgttcgtcaacaactacggcgcg
ggcggcggcgtcgagttgccgttcggcggtaccgggcgctcgggctacggccgcgagaag
ggcttcgaggcgctgtacggcttcaccgtgctgaagacgatcgcgctgcggcacggctga

DBGET integrated database retrieval system