KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3017Help
Entry
BMA10229_A3017    CDS       T00471                                 

Gene name
hisQ-2
Definition
(GenBank) histidine ABC transporter, permease protein
  KO
K10016  histidine transport system permease protein
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bml00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BMA10229_A3017 (hisQ-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bml02000]
    BMA10229_A3017 (hisQ-2)
Transporters [BR:bml02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BMA10229_A3017 (hisQ-2)
   Histidine transporter
    BMA10229_A3017 (hisQ-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ASC
Motif
Other DBs
NCBI-ProteinID: ABN02694
UniProt: A2SAJ2
Position
I:complement(3049289..3049978)
Genome map
AA seq 229 aa AA seqDB search
MFLQGYGPLILSGTWQTVKLAVLSLALSFLLGLVGAAAKLSRSRVSNGIGTLYTTLIRGV
PDLVLMLLLFYSLQIWLNQLTDLMNWDQIDIDPFAAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFARVMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLLAGAIYLAITTISNFVLMWLEKRYSTGVRKADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttcaaggctacggcccgctgatactctccggcacctggcagaccgtcaagctc
gcggtgctgtcgctcgcgctgtcgttcctgctcggcctcgtcggcgcggcggcgaaactg
tcgcgaagccgcgtctcgaacggaatcggcacgctctacacgacgctcattcgcggcgtg
ccggacctcgtgctgatgctgctcctcttctacagcctgcagatctggctgaaccagctc
accgatctgatgaactgggatcagatcgacatcgatccgttcgcggccggcgtgctcgtg
ctcggcttcatctacggcgcgtacttcaccgaaaccttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaggcgggcagcgcgtacgggatgacgaactggcaggtgttcgcg
cgcgtcatgttcccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaatcgacggcgctcgtgtcgatcatcggcctcgccgacgtggtgaaggcg
tcgcaggacgcgggcaagggcacgctgcggttcttcttcttcacgctgctcgccggcgcg
atctatctcgcgatcacgacgatctcgaacttcgtgctgatgtggctcgagaagcgttat
tcgaccggcgtacgcaaggcagacctatga

DBGET integrated database retrieval system