KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3274Help
Entry
BMA10229_A3274    CDS       T00471                                 

Definition
(GenBank) serine protease, subtilase family
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bml01002]
    BMA10229_A3274
Enzymes [BR:bml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     BMA10229_A3274
Peptidases and inhibitors [BR:bml01002]
 Serine peptidases
  Family S53
   BMA10229_A3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: ABN01883
UniProt: A2SB91
Position
I:3326410..3328311
Genome map
AA seq 633 aa AA seqDB search
MRNDEMTSRKWARPRASQAKHAIYAATFFAAAALSAHAAAAWVDTQTGAYPALAQQALAA
SQASAAATAAGKAIDTAPGEPVRVVVSLNLNDEARLDRFLRDLHTPGSAAYGRHLTPAEF
AAQYAPTPQQVALVEAHLRRAGFRDIEVAPNRLLISATGTAAAVKTAFNTRLKRFTLEGR
RVYANQDAAQVPAELGRIVGAVLGLDNATLARTYNRQAAVTGAVGGAKASLAARASDASA
AASGAPVLTGHDPLEFSRIYRAGSTLTASQTTVGVIMAGDAAPVLRDLDTFAAKAGLARV
AATVTRTGPPGSDYSDNSGLSEWDMDSQAIVGAAGGAVKGLVLYAAPSMLLSDITSAYNR
AVVDNVAKVINVSLGVCEADARASGTQAADDRIFKSAVAQGQTFVVAAGDAGAYECSVSR
VSGGQGVPARSNYSVSEPATSPYVVAVGGTTLSIDRTTLAYAGEVAWNEGLQPIGVYDAY
GSYDGTRRLWATGGGYSRSEAAPAWQRSVLGASAKARALPDVAFDADGRSGAHVYVNGRT
EQWGGTSLAAPIFTGIWARVQSDNGNRLGFPLASLYRYAPANGAFAHDVKSGNNGSGGYG
YKAGAGWDPVTGFGSLDIANFAAFVKQTADFAR
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgaggaacgacgaaatgacgtcaagaaaatgggccaggcctcgcgcttcgcaggcgaag
catgcgatttacgcggcgacgttctttgccgcggcggcattgagcgcgcacgcggcggcg
gcatgggtcgacacgcaaaccggcgcgtatccggcgcttgcgcagcaggcgcttgcggcg
tcgcaagcttcggcggcggcaaccgcggccggaaaggcgatcgacacggcgcccggcgag
ccggtgcgggtcgtcgtcagtctcaatctcaacgacgaagcgaggctcgatcgcttcctg
cgcgatctgcatacgcccggcagtgccgcttacggccggcatctgacgcccgccgaattc
gccgcgcagtatgcgccgacgccgcagcaggtcgcgctcgtcgaagcgcatctgcgccgg
gccggattccgcgacatcgaggtggcgccgaaccggctgctgatctcggcgacgggcacc
gccgccgcggtcaagacggcgttcaacacgcggctcaagcgctttacgctcgaaggccgg
cgcgtgtatgcgaaccaggacgcggcgcaggtgcccgccgagctcggccgaatcgttggc
gcggtgctcgggctcgataatgcgacgctcgcgcgcacgtacaaccgccaggcggcggtg
acgggcgcggtcggcggcgcgaaggcgtcgctggccgcgcgcgcgagcgacgcgtcggcc
gccgcgagcggcgcgcccgtgctgacgggacacgatccgctcgaattctcgcgaatctat
cgcgcgggctcgacgctgacggcgtcgcagacgacggtcggcgtgatcatggcgggcgat
gctgcgcccgtgctgcgggatctcgatacgttcgcggcgaaggccgggctcgcgcgcgtc
gcggcgacggtcacgcgtaccgggccgcccggcagcgattacagcgacaattcgggcctg
agcgaatgggatatggacagccaggcgatcgtcggcgcggcgggcggcgcggtgaagggg
cttgtgctctacgcggcgccctcgatgctgctctccgacatcacctcggcgtacaaccgc
gcggtcgtcgacaacgtcgcgaaggtgatcaacgtgtcgctcggcgtgtgcgaggcggac
gcacgcgcgtccggcacgcaggcggcggacgaccgcatcttcaagagcgcggtcgcgcag
gggcagacgttcgtcgtcgcggcgggcgacgcgggcgcgtacgaatgcagcgtgagccgc
gtgtcgggcgggcagggcgtgccggcgcgatcgaactattcggtgagcgagcccgcgacg
tcgccgtacgtcgtcgcggtcggcggcacgacgctgtcgatcgacaggacgacgctcgcc
tacgcgggcgaagtcgcatggaacgagggtttgcagccgatcggcgtgtacgacgcgtac
ggcagctacgacggcacgaggcgtctgtgggcgacgggcggcggctacagccgaagcgaa
gcggcaccggcgtggcagcgaagcgtgctcggcgcgtcggcgaaagcgcgcgcgctgccc
gatgtcgcattcgatgcggacggccgcagcggcgcgcacgtctacgtgaacggccggacc
gagcaatggggcggcacgagcctcgcggcgccgatcttcacgggcatctgggcgcgcgtg
caatccgacaacggcaaccggctcggttttccgctcgcgagcctctatcgctacgcgccg
gccaacggcgcgttcgcgcatgacgtgaaatccggcaacaacggctcgggcggctatggc
tacaaggccggtgcgggctgggatccggtgacgggcttcggcagcctcgacatcgcgaac
ttcgccgcgttcgtcaagcagacggccgatttcgcgcgataa

DBGET integrated database retrieval system