KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_508Help
Entry
MADAR_508         CDS       T01642                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
bmm00010  Glycolysis / Gluconeogenesis
bmm00051  Fructose and mannose metabolism
bmm01100  Metabolic pathways
bmm01110  Biosynthesis of secondary metabolites
bmm01120  Microbial metabolism in diverse environments
bmm01130  Biosynthesis of antibiotics
bmm01200  Carbon metabolism
bmm01230  Biosynthesis of amino acids
Module
bmm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MADAR_508 (tpiA)
   00051 Fructose and mannose metabolism
    MADAR_508 (tpiA)
   00562 Inositol phosphate metabolism
    MADAR_508 (tpiA)
Enzymes [BR:bmm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MADAR_508 (tpiA)
Exosome [BR:bmm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MADAR_508 (tpiA)
  Exosomal proteins of bladder cancer cells
   MADAR_508 (tpiA)
  Exosomal proteins of melanoma cells
   MADAR_508 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Flavodoxin_5 DUF1611
Motif
Other DBs
NCBI-ProteinID: AER40795
UniProt: G7SQI6
Position
complement(507018..507770)
Genome map
AA seq 250 aa AA seqDB search
MRKKVVIANWKMNQDFYETTSFLRNLLKIIFEINHKKEIIIAPSFPFLHISNQILQGSTL
SIAAQNIHQMENGSYTGEVSASMLKSIGVQKVILGHSERRKHFSETNDILIKKIKTALKY
KFIIIFCVGETEVERRKKEHFLSVKYQLEETIFHFSLENISSFIIAYEPIWAIGTGKTAT
PEVVQVMHQYIRSLFMDKYGKNISRKISILYGGSINDLNAKSLFYQKDIDGGLVGNSSLN
IEKFMRIIQS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagttgtaattgccaattggaaaatgaatcaggatttctatgaaactact
tcttttcttagaaacttattaaaaattatttttgaaatcaatcacaaaaaagaaataatt
attgcaccatcttttccttttttacatatttcaaatcaaattttacaggggagtacttta
agtattgctgcacaaaatatccatcaaatggaaaatggatcctatacaggagaagtatct
gcttctatgttaaaatctataggagttcaaaaagtaatattaggacatagcgaacgtagg
aaacatttttcagaaacaaatgatattttaattaaaaaaattaaaactgcattaaaatat
aaatttattattattttttgtgttggagaaacagaagttgaaagaagaaaaaaagaacat
tttttgtccgtaaagtatcaattggaagaaactatttttcatttttctttagaaaatata
agttctttcattatagcatatgaaccaatatgggctattggaacaggaaaaacagctaca
cctgaagtagttcaggttatgcatcaatatattcgttctttgtttatggataaatatgga
aaaaatatttccagaaagatatctattttgtatggaggaagcatcaatgatcttaatgct
aagtctcttttttatcagaaagatatagatggaggtcttgttggaaattcttcactaaat
atagaaaaatttatgagaattattcaatcttaa

DBGET integrated database retrieval system