KEGG   Burkholderia mallei NCTC 10247: BMA10247_0280Help
Entry
BMA10247_0280     CDS       T00479                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00051  Fructose and mannose metabolism
bmn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMA10247_0280
Enzymes [BR:bmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BMA10247_0280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABO07275
Position
I:complement(268376..269158)
Genome map
AA seq 260 aa AA seqDB search
MVDTLKMGKAELVALAQRRLDNEIKDSGWSAREKLALTCRILFDDGHDSGLAGQITCRAD
APHTYYTQRLGLGFDEIAESNLLQVDQDLEVIGGQGIPNPANRFHTWIYRARPDVNCIIH
THPTHVAALSMLETPLVVSHMDTCPLHGDCAFLKDWPGVPVGNEEGEIISNALGDKRAIL
LSHHGQLVVGKTIEEACMLAILIERAARLQLLAIAAGAIAPIPPALAADAHDWISTPKRD
AVTFAYYARRALRRHPDCLD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctc
gacaacgagatcaaggacagcgggtggagcgcgcgcgagaagctcgcgctcacctgccgg
atcctgttcgacgacgggcacgactccggcctcgccgggcagatcacgtgccgcgccgac
gcgccgcacacgtactacacgcagcgcctcgggctcggcttcgacgagatcgccgaatcg
aacctgctgcaggtcgatcaggatctcgaggtcatcggcggccagggcattccgaatccc
gcgaaccgctttcacacgtggatttatcgcgcgcgccccgacgtcaactgcatcatccac
acgcacccgacgcacgtcgccgcgctgtcgatgctcgagacgccgctcgtcgtgtcgcac
atggacacctgtccgcttcacggcgactgcgcgttcctgaaggattggccgggcgtgccc
gtcggcaacgaggaaggcgagatcatctcgaacgcgctcggcgacaagcgcgcgatcctg
ctgtcgcatcacggccagctcgtcgtcggcaagacgatcgaagaggcgtgcatgctcgcg
atcctgatcgagcgcgcggcgcggctgcaactgctcgcgatagcggccggcgcgatcgcg
ccgattccgcccgcgctcgcggccgacgcgcacgactggatctcgacgcccaagcgcgac
gcggtgaccttcgcgtactacgcgcgccgcgcgctacgccgccaccccgactgcctcgac
tga

DBGET integrated database retrieval system