KEGG   Burkholderia mallei NCTC 10247: BMA10247_0659
Entry
BMA10247_0659     CDS       T00479                                 

Definition
(GenBank) Rhs element Vgr protein
Organism
bmn  Burkholderia mallei NCTC 10247
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: ABO06692
UniProt: A0A6C6YUX1
Position
I:639532..642339
AA seq 935 aa
MSVITQFTSLFSAANCLYCLDGPGEIASLQIERWVGRETLSENFQWDVYALATDPGLDLD
AMLGQRVTIRTALANGTSAVRSGLVAQAECIGYDAGLARYCLQLVPWLAALAHGRDERTF
VRQGVADVLGAVFAPYGAIARWRFTADANQRIAELGARDYRVQYRTHTHFDFVRHVLAEA
GLGFCFVEEADAPAGHTMLIFDDSTQLPEDETSARMGGVPQRLSGTATEPDDVIVGIGQS
LSLTADRVTLISSDYRGNQSTSATASLGNPAGSRELYDDVGPEAFDSLREADAAARRHAD
AIVSAARFWTGYGTLRTARAGRALRIAGATWRMSRGGAPAPDAFVLTRVDQIGINNLPAT
VMERVERSLGPLPPANLDARVLAQAKAGGYANRFDAAPRDQAWRPTLEDGTGQRLNPVPT
ALGAQTAIVVGPQGETRPGSTGPVHTDAQGRLRLRYHWQADGDAGTYPTRAMQRLASEGH
GLQQTPRIGHEVLVQFVNGLVHRPIVLGGLFNGRGEGGEAPTPGGEAGQPLDESVYAQAS
DHAASAQGNLAGGHSPAWHGAGGGAKRHDHAGALSGFKSQEFDGQGYNQLVADDTDRMGR
MQMATTHAATQLNIGHLRHQADNYLGSFRGQGVELRSDAYGALRGARGVLISSYAPTGPS
QPAGDASALQSLLAQQAALAKLLDKSADTHKTLPFAAQRGAQRAGQSSMNGDAAPLDALG
KSFATTVGADGYAQASADASRRATGNALPHTGDAVLGVEAKGGQGLLAGQSLQWAAGETL
TIGSGNDTNLAVNRTLRVHSGQGIGWLAGANGANGAQGVGMSVIAGKDDLALQAQHDLMA
LRARDDLRVASIGADVEIAAKQTVRLAVSGGAHLTIEGGNVTFGCPGSLVVHAAQHTFVG
PDQLAPALPQFPEKVCVECLKHAMQSGSALAGKAI
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgagcgtgatcacgcaattcacgtcgcttttcagcgctgccaattgtctctattgtctc
gacggtccgggcgaaatcgcgtcgctgcagatcgagcgctgggtggggcgggagacgctc
tccgagaacttccagtgggatgtctacgcgctcgcgaccgatcccggcctcgacctcgac
gcgatgctcgggcagcgcgtgacgatccgcacggcgctcgcgaacggcacgagcgccgtg
cgcagcgggctcgtggcgcaggccgagtgcatcggctacgacgccggcctcgcgcgctac
tgcctgcagctcgtgccgtggctcgccgcgctcgcgcacggccgcgacgagcgcacgttc
gtgcggcagggcgtcgccgacgtgctcggcgcggtgttcgcgccgtacggcgcgatcgcc
cgctggcgcttcaccgcggacgcgaaccagcgcatcgcggaactcggcgcgcgcgactac
cgcgtgcagtaccgcacccacacgcatttcgatttcgtccggcacgtgcttgccgaagcg
ggtctcggcttttgcttcgtcgaggaggcggacgcgcccgcgggccacacgatgctgatc
ttcgacgacagcacgcagttgcccgaggacgagacttccgcgcgcatgggcggcgtgccg
cagcggctgagcggcacggcgaccgagccggacgacgtgatcgtcggcatcgggcagtcg
ctgtcgctgaccgcggatcgcgtcacgctgatcagcagcgactaccgcggcaaccagtcg
acgagcgcgacggcgagcctcggcaatccggccggatcgcgcgagctgtacgacgacgtc
gggccggaggcgttcgacagcctgcgcgaggccgacgccgccgcgcggcggcacgcggac
gcgatcgtctcggcggcgcgcttctggacaggctacggcacgttgcgcaccgcgcgcgct
ggccgcgcgctgcgcatcgcgggcgcgacgtggcgcatgtcgcgcggcggcgcgccggcg
cccgatgcgttcgtgttgacgcgcgtcgatcagatcggcatcaacaatttgcccgcgacg
gtgatggagcgcgtcgagcgcagcctcggcccgctgccgcccgcgaatctcgacgcgcgc
gtgctcgcgcaggcgaaggcgggcggctatgcgaaccggttcgacgccgcgccgcgcgac
caggcatggcgcccgacgctggaggacggcaccggccagcgactgaacccggtgccgacg
gcgctcggcgcgcagacggcgatcgtcgtcgggccgcagggcgagacgcggccgggctcg
acgggcccggtgcataccgacgcgcagggccggttgcggctgcgctatcactggcaggcg
gacggcgacgcgggcacctatccgacgcgcgcgatgcagcggctcgcgagcgaggggcac
gggctgcagcagacgccgcggatcggccacgaggtgctcgtgcagttcgtcaacggcctc
gtgcaccggccgatcgtgctcggcgggctgttcaacggccgcggcgagggcggcgaagcg
ccgacgcccggcggcgaagcggggcagccgctcgacgaatcggtctacgcacaggcgagc
gaccacgcggcgagcgcgcaaggcaatcttgcgggcggccatagccccgcgtggcacggc
gcgggcggcggcgcgaagcgccacgatcacgcgggcgcgctgtccggcttcaagagccag
gagttcgacggccagggctacaaccagctcgtcgcggacgataccgatcgcatgggccgc
atgcagatggcgacgacgcacgcggcgacccagctcaatatcggccatttgcggcatcag
gccgacaactatctcggcagcttccgcgggcaaggcgtcgagctgcgctcggacgcgtac
ggcgcgctgcgcggcgcgcgcggcgtgctgatctccagctatgcgccgacggggccgtcg
cagccggcgggcgatgcgtcggcgctgcagtcgctgctcgcgcaacaggcggcgctcgcg
aagcttctcgacaaatcggcggacacgcacaagaccttgccgttcgccgcgcagcgtggc
gcgcagcgggccggacagtcgtcgatgaacggcgacgccgcgccgctcgacgcgctcggg
aagagtttcgcgacgacggtcggcgccgacggctacgcgcaggcgtcggccgacgcatcg
cgccgcgcgacgggcaatgcgctgccgcataccggcgacgcggtgctcggcgtcgaggcg
aagggcggccaggggctgctggccggccagtcgctgcaatgggcggcgggcgagacgctg
accatcggcagcggcaacgacaccaacctcgcggtcaaccggacgttgcgcgtgcacagc
gggcagggcatcggctggcttgccggcgcgaacggcgcgaacggcgcgcagggcgtcggc
atgagcgtgatcgccggcaaggacgatctggcgctgcaggcgcagcacgacctgatggcg
ctgcgcgcgcgcgacgatctgagggtcgcgtcgatcggcgcggacgtcgagatcgcggcg
aagcagaccgtgcggctcgcggtcagcggcggcgcgcatctgacgatcgaaggcggcaac
gtcacgttcggctgcccgggctcgctcgtcgttcatgcggcccagcatacgttcgtcggg
ccggatcaactggctcccgcgctgccgcagtttcccgagaaggtgtgcgtcgaatgcctg
aagcacgcgatgcaatcgggcagcgcactggccggcaaggcgatctga

DBGET integrated database retrieval system