KEGG   Burkholderia mallei NCTC 10247: BMA10247_1076Help
Entry
BMA10247_1076     CDS       T00479                                 

Gene name
bktB
Definition
(GenBank) acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00071  Fatty acid degradation
bmn00072  Synthesis and degradation of ketone bodies
bmn00280  Valine, leucine and isoleucine degradation
bmn00310  Lysine degradation
bmn00362  Benzoate degradation
bmn00380  Tryptophan metabolism
bmn00620  Pyruvate metabolism
bmn00630  Glyoxylate and dicarboxylate metabolism
bmn00640  Propanoate metabolism
bmn00650  Butanoate metabolism
bmn00900  Terpenoid backbone biosynthesis
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
bmn01130  Biosynthesis of antibiotics
bmn01200  Carbon metabolism
bmn01212  Fatty acid metabolism
bmn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMA10247_1076 (bktB)
   00630 Glyoxylate and dicarboxylate metabolism
    BMA10247_1076 (bktB)
   00640 Propanoate metabolism
    BMA10247_1076 (bktB)
   00650 Butanoate metabolism
    BMA10247_1076 (bktB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BMA10247_1076 (bktB)
   00072 Synthesis and degradation of ketone bodies
    BMA10247_1076 (bktB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMA10247_1076 (bktB)
   00310 Lysine degradation
    BMA10247_1076 (bktB)
   00380 Tryptophan metabolism
    BMA10247_1076 (bktB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BMA10247_1076 (bktB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMA10247_1076 (bktB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BMA10247_1076 (bktB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bmn04147]
    BMA10247_1076 (bktB)
Enzymes [BR:bmn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BMA10247_1076 (bktB)
Exosome [BR:bmn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMA10247_1076 (bktB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABO06846
Position
I:complement(1068839..1070023)
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREVLSRAQVSGDEVGHVVFGNVVHT
EPKDMYLARVAAINGGVAQHAPALTVNRLCGSGLQAIVSAAQNVLLGDADIAVAGGAENM
SRAPYSVPAARFGQRMGDAKLVDMMIGALNDPFQSIHMGVTAENVAAKYGITRDAQDALA
LESHRRASHATKSGYFKDQILPIEIASRKGTVVFDADEHVRHDASLDDFTKLKPVFAKEN
GTVTAGNASGINDAAAAVVLMERGVADKRGAKPLARLVSYAHAGVDPAYMGIGPVPATKK
ALERAGITVADLDVIEANEAFAAQACAVSNALGLDPAKVNPNGSGISLGHPIGATGALIT
VKALYELQRIGGRYALVTMCIGGGQGIAAVFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtagtggtggtgagcggcgtacgcacggcgatcggcgatttcggcggc
agcctgaaggacttcgcgccgaccgagctcggcgcgcgggtcgtgcgcgaggtgctgtcg
cgcgcgcaggtgtcgggcgacgaggtcggccacgtcgtgttcggcaatgtcgtgcacacg
gagccgaaggacatgtatctcgcgcgcgtcgcggcgatcaacggcggcgtcgcgcagcac
gcgcccgcgctgacggtcaaccgtctctgcggctccggcctgcaggcgatcgtgtcggcc
gcgcagaacgtgctgctcggcgacgcggacatcgcggtcgcgggcggcgcggagaacatg
agccgcgcgccgtactcggtgccggccgcgcgcttcggccagcgcatgggcgatgcgaag
ctcgtcgacatgatgatcggcgcgctcaacgatccgttccagtcgattcacatgggcgtg
acggccgagaacgtcgcggcgaagtacgggatcacgcgcgacgcgcaggacgcgctcgcg
ctcgaatcccaccggcgcgcgtcgcatgcgacgaaatccggctatttcaaggatcagatc
ctgccgatcgagatcgcgtcgcgcaagggcacggtcgtgttcgacgccgacgagcacgtg
cgccacgacgcgtcgctcgacgacttcacgaagctcaagcccgtgttcgccaaggagaac
ggcacggtgacggcgggcaacgcgtcgggcatcaacgatgcggccgccgcggtggtgctg
atggagcgcggcgtcgccgacaagcgcggcgcgaagccgctcgcgcgcctcgtctcgtat
gcgcacgcgggcgtcgatccggcatacatgggcatcggccccgtgcccgcgacgaagaag
gcgctcgagcgcgcgggcatcaccgtcgccgatctcgacgtgatcgaggcgaacgaggcg
ttcgccgcgcaggcgtgcgcggtgtcgaacgcgctcggtctcgatccggcgaaggtcaac
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgacgggcgcgctcatcacc
gtgaaggcgctgtacgagctgcagcggatcggcgggcgctacgcgctcgtcacgatgtgc
atcggcggcgggcagggcattgccgcggtgttcgagcgtctgtga

DBGET integrated database retrieval system