KEGG   Burkholderia mallei NCTC 10247: BMA10247_1502Help
Entry
BMA10247_1502     CDS       T00479                                 

Gene name
pdhA
Definition
(GenBank) pyruvate dehydrogenase complex E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00010  Glycolysis / Gluconeogenesis
bmn00020  Citrate cycle (TCA cycle)
bmn00620  Pyruvate metabolism
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01120  Microbial metabolism in diverse environments
bmn01130  Biosynthesis of antibiotics
bmn01200  Carbon metabolism
Module
bmn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10247_1502 (pdhA)
   00020 Citrate cycle (TCA cycle)
    BMA10247_1502 (pdhA)
   00620 Pyruvate metabolism
    BMA10247_1502 (pdhA)
Enzymes [BR:bmn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     BMA10247_1502 (pdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABO06659
Position
I:complement(1492290..1494965)
Genome map
AA seq 891 aa AA seqDB search
MMKYVAAERDDDAQETVEWLEALDGVISSVGPGRAHYLIEKQIEFARMHGEHLPFSANTP
YINTIPVEAQAKIPGDQDIEHRIRSYTRWNAIAMVLRAGKHTNVGGHIASFASAATLYDV
GYNHFWHAPSAEHGGDLVFVQGHSSPGIYSRAFLLGRLTEDQLDNFRQEVGGNGISSYPH
PWLMPDFWQFPTVSMGLGPIMAIYQARFMKYLQARGIVKTEGRKVWAFLGDGETDEPESL
GAIGMASREKLDNLVFVINCNLQRLDGPVRGNGKIIQELESEFRGAGWNVIKVIWGSRWD
ALFARDKTGALMRRMMEAVDGEYQTYKSESGAYVREHFFNTPELKALVADWSDDDIWNLN
RGGHDPHKIYAAFHEASNSKGAPTVILAKTIKGYGMGEAGQAMNITHQQKKLPVEQLKKF
RDQFRLPIADDVIADVPYLKFDEGSKELEYMRAHRQALGGYLPQRRQKAQSLPVPALDAF
EPLLKGTGEGREISTTMAFVRILNILLKDKALGKRVVPIVPDESRTFGMEGLFRQIGIWN
QEGQKYVPEDSDQLMFYKESETGQILQEGINEAGGMCDWIAAATSYSTHGEIMVPFYIFY
SMFGFQRIGDLAWAAGDMRSRGFLLGGTAGRTTLNGEGLQHEDGHSLMWAASVPNCVSYD
PTFGYELAVIVQDGLRRMVQEQEDVYYYVTVMNENYEHPAIPQGEHVAADIIKGMYAFRK
ADADKKAPRVQLLGAGTIFNEVIAAADLLKNDWGVAADLWSVPSFTELAREGHDVERWNL
LHPAEARRLSHVQTCLKDTQGPVIASTDYVRALADQIRGQIDRRYVVLGTDGFGRSDTRG
ALRHFFEVDRYWVTVAALNALADEGTIERKVVADAIAKYNLDPAKPNPMTV
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaagtacgtcgcagccgaacgcgacgacgacgcgcaggaaaccgtcgaatggctc
gaagcgctcgacggcgtgatttcgtcggtcggccccggccgcgcgcactacctgatcgaa
aagcagatcgaattcgcgcgcatgcacggcgagcacttgccgttctccgcgaacaccccg
tacatcaacacgattcccgtcgaagcccaggcgaagattccgggcgaccaggacatcgag
caccggatccgctcgtacacgcgctggaacgcgatcgcgatggtgctgcgcgcgggcaag
cacacgaacgtcggcggccacatcgcgtcgttcgcttcggccgcgacgctctatgacgtc
ggctacaaccacttctggcacgcgccgtccgccgagcacggcggcgatctcgtgttcgtg
cagggccactcgtcgcccggcatttattcgcgcgcgttcctgctcggccgcctgacggaa
gatcagctcgacaacttccgccaggaagtgggcggcaacggcatctcgtcgtatccgcac
ccgtggctgatgccggatttctggcagttcccgaccgtgtcgatgggcctcggtcccatc
atggcgatctatcaggcgcgcttcatgaagtacctgcaggcgcgcgggatcgtgaagacg
gaaggccgcaaggtctgggcgttcctcggcgacggcgagaccgacgagccggaatcgctc
ggcgcgatcggcatggcgagccgcgagaagctcgataacctcgtgttcgtgatcaactgc
aacctgcagcgtctcgacggcccggtgcgcggcaacggcaagatcatccaggagctcgaa
tcggagttccgcggcgccggctggaacgtgatcaaggtgatctggggcagccgctgggat
gcgctgttcgcgcgcgacaagacgggcgcgctgatgcgccggatgatggaagccgtcgac
ggcgagtatcagacgtacaagtcggagtcgggcgcgtacgtgcgcgagcacttcttcaac
acgccggagctgaaggcgctcgtcgccgactggtccgacgacgacatctggaacctgaac
cgcggcggccacgatccgcacaagatctacgcggcgttccacgaggcgagcaattcgaag
ggcgcgccgacggtgatcctcgcgaagacgatcaagggctacgggatgggcgaagccggc
caggcgatgaacatcacgcaccagcagaagaagttgcccgtcgagcaactgaagaagttc
cgcgaccagttccgcctgccgatcgccgacgacgtgatcgccgacgtgccgtacctgaag
ttcgacgaaggctcgaaggaactcgagtacatgcgcgcgcaccgccaggcgctcggcggc
tatctgccgcagcgccgccagaaggcgcaatcgctgccggtgccggcgctcgacgcgttc
gagccgctgctcaagggcacgggcgaaggccgcgagatctcgacgacgatggcgttcgtg
cggatcctgaacatcctgctgaaggacaaggcgctcggcaagcgcgtcgtgccgatcgtg
ccggacgaatcgcgcacgttcggcatggagggcctgttccgccagatcggcatctggaac
caggaaggccagaagtatgtgccggaagattccgatcaactgatgttctacaaggaatcg
gaaaccggccagatcctgcaggaaggcatcaacgaagcgggcggcatgtgcgactggatc
gcggcggcgacgtcgtactcgacgcacggcgagatcatggtgccgttctatatcttctat
tcgatgttcggcttccagcgcatcggcgatctcgcgtgggcggcgggcgacatgcgctcg
cgcggtttcctgctcggcggcaccgcgggccgcacgacgctcaacggcgaaggcctgcag
cacgaagacggccactcgctgatgtgggcggcttcggtgccgaactgcgtgagctacgat
ccgacgttcggctacgagctcgccgtcatcgtgcaggacggcctgcgccggatggtgcag
gagcaggaggacgtctactactacgtgacggtgatgaacgagaactacgagcacccggcg
attccgcagggcgagcacgtggcggccgacatcatcaagggcatgtacgcgttcaggaaa
gccgacgccgacaagaaggcgccgcgcgtgcaactgctcggcgcgggcacgatcttcaac
gaagtgatcgccgcggcggacctgctgaagaacgactggggcgtcgccgccgatctctgg
agcgtgccgagcttcaccgagctcgcgcgcgaaggccatgacgtcgagcgctggaacctg
ctgcatccggccgaggcgcgccgcctgtcgcacgtgcagacgtgcctgaaggacacgcag
ggcccggtgatcgcgtcgaccgactacgtccgcgcgctcgccgaccagatccgcggccag
atcgaccgccgctacgtcgtgctcggcaccgacggcttcggccgctcggacacgcgcggc
gcgctgcgccacttcttcgaggtggaccgctactgggtcacggtcgcggcgctcaacgcg
ctcgccgatgaaggcacgatcgagcgcaaggtcgtcgccgacgccatcgcgaagtacaac
ctcgacccggccaagcccaacccgatgacggtttaa

DBGET integrated database retrieval system