KEGG   Burkholderia mallei NCTC 10247: BMA10247_3146
Entry
BMA10247_3146     CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_3146
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_3146
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABO05493
UniProt: A0A6C6YSI3
Position
I:3106505..3107605
AA seq 366 aa
MQTAQRRIDPGVVERLLDEPHRFEFFQAVRLLETWFAKHDAPRHAASRPGEIVARRIGFR
NTLSLGFPPSEIERAQSYDAAGAALKDDVRRNAALEAGALSRVELTPAFFGLLGGQGALP
LHYTEQIIAREQLKRDHAAHAFFDVFSNRATALFYSAWKKYRLPLHYELDRDERYLPLLL
ALAGVSNDDARSTVQQGRGALLDEAIAGYALAARHRPVSAAYLQRTLSEYFRVPIRVEQF
VGKWYDVPPDQLSVLGDVNVTLGATALVGERVWQRDMRARLVVGPLTKRDYEAFLPGEER
AIALERMLTLLAGVTLEYEVSLVLRRAEVGASVLGAGARLGWDAFLCTREAGRDRADARY
ELHVIH
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcaaaccgcgcagcggcgaatcgatcctggcgtagtcgagcggctgctcgacgagccg
catcgcttcgagttctttcaggcggtgcggctgctcgagacctggttcgcgaagcacgat
gcgccgcgccacgcggcgagccggccgggcgagatcgtcgcgcggcgcatcggctttcgc
aatacgctgtcgctcggctttccgccgagcgagatcgagcgcgcgcagtcgtacgacgca
gccggcgccgcgctgaaggacgacgtgcggcgcaacgcggcgctcgaggcgggcgcgctg
tcgcgcgtcgagctcacgccggcgttcttcgggctgctgggcggccagggcgcgctgccg
ctgcattacaccgagcagatcatcgcgcgtgagcaactgaagcgcgaccatgccgcgcac
gcattcttcgatgtcttctcgaaccgcgcgaccgcgctgttctattcggcatggaagaag
taccgtctgccgctgcattacgaactcgaccgcgacgagcgctatctgccgctcctgctc
gcactcgcgggcgtatcgaacgacgacgcgcgctcgaccgtgcagcagggccgcggcgcg
ctgctcgacgaggcgatcgcgggctatgcgctcgccgcgcggcatcggccggtatcggcc
gcgtatctgcagcgcacgctgtccgaatattttcgcgtgccgatccgcgtcgagcagttc
gtcggcaagtggtacgacgtgccgcccgatcaattgagcgtgctcggcgacgtgaacgtg
acgctcggcgcgacggcgctcgtcggcgagcgcgtgtggcagcgcgacatgcgcgcgcgg
ctcgtcgtcggcccgctgacgaagcgcgactacgaggcgttcctgcccggcgaggagcgc
gcgatcgcgctcgagcggatgctgacgctgctcgcgggcgtgacgctcgaatacgaggtg
tcgctcgtgctgcgccgcgcggaagtcggcgcgagcgtgctcggcgcgggcgcgcggctc
ggctgggacgcgtttctctgcacgcgcgaagccgggcgcgaccgtgcggacgcgcgctac
gagctgcatgtcattcattga

DBGET integrated database retrieval system