KEGG   Burkholderia mallei NCTC 10247: BMA10247_3151Help
Entry
BMA10247_3151     CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10247_3151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_3151
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C
Motif
Other DBs
NCBI-ProteinID: ABO04720
Position
I:complement(3113641..3117534)
Genome map
AA seq 1297 aa AA seqDB search
MQRFLNVLTHPRTLTIVGFAALAAVLFIAADALQIGLVWAAVALGVALALWLATKLWRRW
RVRRANRQLGDMLEQQAETGKMSAAVAEPAKRAELDVLRTRLADTVKTIKTSKIGQVSGG
SALYELPWYIVIGNPAAGKSSAVINSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILL
DTAGRYSVHEEDRSEWLGFLDLLKRYRPKAPINGIIVTASIAELTGNRPEFAINLAKNLR
QRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSNDRQEYDRVWGATLPYEPDEKRDVV
ALFDQRFEELYDGLKEISVAQLSVSRGNKLSPGQLSFPLEFSTIKPALRSFLATLFEDNP
FQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDSQSLPKPHSAFSKNGFFLRDLFSK
VIFADRQTVRQFASPTKTRVRYATFFGFVAALALALGGWTWSTIGNQQLVSNVQADLDNV
TRLQQNRNDLQSRLQAMDILEDRIEQLEQFRRDKPLSVSLGLYQGNRLEQHLLTEYYNGV
RQILLAPVSDNLASFLKDVNAHPDQLAPMTRAPESGATPAGPMPVSTHPAAPGAAPSPAV
AQGRQQGGLYNDASPTNVEDAYNALKTYLMLSDKRHVEQAHLTDQVARFWRGWLETNRGN
MPRDEMIRSAERMITFYLSRVSDNDWPMIEANLALVDQTRENLRRVVRGMPARQRVYEEI
KARASTRFAPMTIARIVGEGNTGLVAGSYAIPGTFTRDAWFQYVQPAIRDAATKELQAKD
WVLNTASADDLTLEGSPEQIQKTLVAMYKTEYAQHWQKFMQGIAVQGFGNFTQAVDAMNK
LGDPQDSPIRKVLETAYDQTSWDNPSLANATIKKAQTGVVNWVKQWFTRQPGGQIAANVD
INGNPADVPMGPIGQEFVGLGRIVATHDGTSMLKGYMDTLSKVRTRFNVIKNQGDPGPGA
RQLMQQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASVE
VNKVWNAQVYQPFQNSLANKYPFAAGAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVR
RGDTLSARTWGDMGLALTPDFTGGFARWVAPLAGGAATSAAASSEPQTVFQVLPQPSSGT
TEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPGATLSATTFDGRTLQLVNEPGRYGLEK
LINSAQRKRRPDGTFDLTWTQGSVSVSVTMRIISTSQPTGGGDQPQQQSLRGLRLPSSVA
DASAGGAANATAQPGSGAAAAQVAATAASASNAQGAQ
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcttcctcaacgtgttgactcaccctcgcacgctcacgatcgtcggcttcgcc
gcgctcgcggcggttctgttcatcgcggccgacgcgctccagatcggcctcgtatgggcg
gccgtcgcgctcggtgtcgcgctcgcgctctggctcgcgacgaagctctggcgccgctgg
cgcgtgcgccgcgcgaaccgccagctcggcgacatgctcgagcagcaggccgaaacgggc
aagatgtccgccgccgtggccgagcccgcgaagcgcgcggagctcgacgtgctgcgcacc
cgcctcgccgacacggtgaagacgatcaagacttcgaaaatcggccaggtgtcgggcggc
tccgcgctgtacgaactgccgtggtacatcgtgatcggcaatccggccgcgggcaagagc
agcgccgtcatcaactcggggttgcagtttccgttcgcggacaagaacagcgcggtgatc
cacggcatcggcggcacgcgcaactgcgactggttcttcacgaccgaaggcatcctgctc
gacaccgcgggccgctattcggtgcacgaggaagaccgcagcgaatggctcggctttctc
gatctgctcaagcgctatcgcccgaaggccccgattaacggcatcatcgtgacggcgagc
atcgccgagctcaccggcaatcgccccgaattcgcgatcaacctcgcgaaaaacctgcgc
cagcgcgtgcaggagctcaccgagaagctcgaagtgttcgcgcccgtctacgtgatgttc
acgaaggccgacctgatcacgggcttcaccgaattcttcagcagcaacgatcgccaggaa
tacgaccgcgtgtggggcgcgacgctgccgtacgagcctgacgagaagcgcgacgtggtc
gcgctgttcgatcagcgcttcgaggaactgtatgacgggctcaaggaaatcagcgtcgcg
cagctgtcggtgagccgcggcaacaagctctcgcccggccagttgagcttcccgctcgaa
ttttcgacgatcaagcccgcgctgcgctcgttcctcgcgacgctgttcgaggacaacccg
ttccagtacaagccgatcttccgcggcttctacttcacgagcgcgctgcaggaaggcgaa
acgaacagcgcggccgcgcagcggatcgcgcaccgcttcgggctcgattcgcaaagcctg
ccgaagccgcacagcgcgttctcgaagaacggcttcttcctgcgcgacctgttttcgaag
gtgatcttcgccgatcgccagacggtccgccagttcgcgagcccgacgaagacgcgcgtg
cgctacgcgacgttcttcggcttcgtcgcggcgctcgcgctcgcgctcggcggctggacc
tggtcgacgatcggcaaccagcagctcgtctcgaacgtgcaggccgacctcgacaacgtg
acccgcctgcagcagaaccgcaacgatctgcaatctcgcctgcaggcgatggacatcctc
gaggatcggatcgagcagctcgagcagttccggcgcgacaagccgctgtccgtctcgctc
ggcctgtatcagggcaatcggctcgagcagcacctgttgaccgagtactacaacggcgtg
cggcagatcctgctcgctcccgtgtcggacaatctcgcgtcgttcctgaaggacgtgaac
gcgcatccggaccagctcgcgccgatgacgcgcgcgcccgaatcgggcgcgacgccggcc
ggcccgatgccggtatcgacccatcccgcggcgccgggcgcggccccctcccccgccgtc
gcgcagggccggcagcagggcggcctctataacgacgcgtcgccgaccaacgtcgaggac
gcgtacaacgcgctgaagacctacctgatgctctccgacaagcggcacgtcgagcaggcg
cacctgaccgatcaggtcgcgcgcttctggcgcggctggctcgagacgaatcgcggcaac
atgccgcgcgacgagatgatcaggagcgcggagcgaatgatcacgttctacctgtcgcgc
gtgtccgacaacgactggccgatgatcgaggcgaatctcgcgctcgtcgaccagacccgc
gagaacctgcgccgcgtcgtgcgcggcatgccggcccgccagcgcgtgtatgaagagatc
aaggcgcgcgcgtcgacccgcttcgcgccgatgacgatcgcgcgcatcgtcggcgaaggc
aacaccggcctcgtcgcgggcagctacgcgatccccggcacgttcacgcgcgacgcgtgg
ttccagtacgtgcagccggcgatccgcgacgccgcgacgaaggagctgcaggcgaaggat
tgggtgctgaacaccgcgtcggcggacgatctgacgctcgagggcagccccgagcagatc
cagaaaacgctcgtcgcgatgtacaagaccgagtacgcacagcactggcagaagttcatg
cagggcatcgcggtgcagggcttcggcaatttcacgcaggcggtcgacgcgatgaacaag
ctcggcgatccgcaggattcgccgatccgcaaggtgctcgagaccgcgtacgaccagacc
tcgtgggacaacccgtcgctcgcgaacgcgacgatcaagaaggcgcagacgggcgtcgtg
aactgggtcaagcagtggttcacgcgccagccgggcggccagatcgcggcgaacgtcgac
atcaacggcaatcccgccgacgtgccgatgggcccgatcggtcaggagttcgtcgggctc
ggccggatcgtcgccacgcacgacggcacgtcgatgctcaagggctacatggacacgctg
tcgaaggtccgtacgcgctttaacgtgatcaagaaccagggcgaccccggccccggcgcg
cgtcagctgatgcagcagacgctcgacggcaacggctcggagctcgccgattcgctgaag
ttcgtcgacgagcagatgctcacgggcttgaccgattcgcaacgcaaatcgctgcgcccg
cttctcgtgcgcccgctgatgcaggcgttcgcggtcgtgatccagccggcgagcgtcgag
gtgaacaaggtatggaacgcgcaggtgtaccagccgttccagaactcgctcgcgaacaag
tatccgttcgcggcgggcgcgaaggtcgaggcgggcgcgggcgagatcgcgcaggtgttc
ggccccgacggctcgatcgcgaagttcgtcggcacgacgctcggcccgctcgcggtgcgc
cgcggcgacacgctgtccgcgcgcacctggggcgacatgggcctcgcgctcacgccggac
ttcacgggcggcttcgcgcgctgggtcgcgccgctcgcgggcggcgcggcgacgagcgcg
gccgcgtcgtccgagccgcagaccgtgttccaggtgctgccgcagccgagcagcggcacg
accgaatacacgatcgcgatcgacggccagcagctgcgctaccgcaacacgccgccgcaa
tggacgaacttcgtgtggccgaacccgcagggctcgcccggcgcgacgctgtccgcgacg
accttcgacggccgcacgttgcagctcgtcaacgagccgggccgctacggcctcgagaag
ctgatcaactcggcgcagcgcaagcgccgtccggacggcacgttcgatctgacatggacg
cagggcagcgtcagcgtctcggtgacgatgcgcatcatcagcacctcgcagccgacgggc
ggcggcgatcagccgcagcagcaaagcctgcgcggcctgcgcctgccttcgtcggtcgcc
gacgcgagcgcgggcggcgcggccaatgcgacggcgcaacccggctcgggcgccgcggcc
gcgcaggtcgccgccacggccgcttccgcatcgaacgcacagggggcgcaatga

DBGET integrated database retrieval system