KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0446Help
Entry
BMA10247_A0446    CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A0446
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABO02561
Position
II:386537..387940
Genome map
AA seq 467 aa AA seqDB search
MNEPVLSATPAAALRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQ
IDRELLALGKVALLAATGVMRDGTPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGA
QEVSFGAGGNGEGHGGDGNAHAGFARYVVREYEVADANEVALGPALLQTGRLNVRLMLES
ELTGDWQALGVARVVERRTDGRLLVDDGYIPPRLVAQRDPVLLRHTRELHGLLTQRSEAL
GERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAHPETLFCDWLKLACDLSTFT
AAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGNGMKVATIADP
ALRDTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQI
PYHAGHTYFEIDKGGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagccggtattgtccgcgacccccgctgcggcgttgcgccagcgcgtgatctgg
accgagggcatgttcctgcggccgcagcatttccagcagctcgagcggcactgggagcgc
tacgtcggcatgcgctgcctgccgctgcaaggcttctactggggctacgacgagttgcag
atcgatcgcgagctgctcgcgctcggcaaggtcgcgctgctcgccgcgaccggcgtgatg
cgcgacggcacgccgttcgacctgtcgcatccggacgaccggcccgagccgctcgacgtg
cccgccgacgcgaaggatcagctcgtcgtgctcgcgctgccgctgtggcgcggcggcgcg
caggaggtgtcgttcggcgcgggcggcaacggcgaaggccacggcggcgacggcaacgcg
cacgcgggcttcgcgcgctacgtcgtgcgcgaatacgaagtcgccgacgcgaacgaggtc
gcgctcggccccgcgctattgcagaccggccgcctgaacgtgcgcctgatgctcgaatcc
gaattgacgggcgactggcaggcgctcggcgtcgcgcgcgtcgtcgagcggcgcaccgat
gggcggctgctcgtcgacgacggctacattccgccgcggcttgtcgcgcagcgcgatccg
gtgctgctgcgccacacgcgcgagctgcacgggctgctcacgcaacgcagcgaggcgctc
ggcgagcgcctgtcggagccggggcgcggcggcgtgtccgaagtcgccgatttcctgctg
ctgcaactcgtcaaccgctatctggcgctcacgtggcacgcgcagcaggatgtcgccgcg
cacccggagacgctgttctgcgattggctgaagctcgcgtgcgacctgagcacgttcacc
gcggccggccgccggccgcagtcgctcgcggtctaccggcacgacgatctgcgcgcgagc
ttcggcgagctgatggccgagctgcgccgctcattgtcgacggtgctcgagcagaacgcg
atccagatcgagctgcgcgacgtgggcaacggcatgaaggtcgcgacgatcgccgatccg
gcgctgcgcgacaccgcgggcttcgtgctcgccgtgcgcgccgacgtgccggccgacagc
ctgcgcgcgcgctttcccgcgcaggcgaagctcggtcccgtcgagcgcattcgcgatctc
gtgcagttgcaactgccgggcatcgcgatgcggcagttgcccgtcgcgccgcggcagatt
ccgtatcacgcgggccacacgtacttcgagatcgacaagggcggcgagatgtggaaacag
ctcgaacgctcgggcggcctcgcatttcatttcgccggcgaattcccgggactctcgatg
gagttctgggcgattcgcgggtga

DBGET integrated database retrieval system