KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0457
Entry
BMA10247_A0457    CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A0457
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A0457
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABO02636
UniProt: A0A6C6YK17
Position
II:401023..402894
AA seq 623 aa
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARV
QLKMDAEFPRFTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARP
AAAEQTACEFRTAHDLTLWPLELADASVTGAPAYLPRSATAARRDVRGALRIRLKARGGA
GLAQLPIDRLMFHLAGPERDALHLLELIAGHTIGVVCHDAAQPPRWLHALGAHALAHQGF
DADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRPALARATGDTFELTLLLDRHD
AALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLDYEVYAVRRLA
GEQRDDGQTRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPR
PPLADAQSAWRLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRV
AFAPVFRRLPAAGPLMFGRGVQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAEC
VLSSAQRGRLAQWPARVGRRPAI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggatacgcgcctgctcgactactacaaccgcgagctcgcgtatctgcgcgagttgggc
ggcgagttcgcgcagcagtttccgaaagtggccgcgcgcctgcggatgcacgaatcgggg
ccgcccgatccgtacgtcgagcggttgctcgaaggcttcagctttctcaccgcgcgcgtg
caactgaagatggacgcggagtttccgcgcttcacgcaggcgctgctcgacgcggtgtat
ccgggttacgtcgcgccgcttccgtcgatggcgatcgtgcagttcacgccgatgatgaac
gaaggcagcctcgcgcagggctaccggctgccggcgggcaccgcgctgcgcgcgcggccc
gccgcggccgaacagaccgcgtgcgagtttcgcaccgcgcacgatctgacgctgtggccg
ctggagctcgcggacgcttcggtgacgggcgcgcccgcgtatctgccgcgttcggcgacg
gcagcgcgccgcgacgtgcgcggcgcgctgcgcatccggctgaaggcgcgcggcggcgcg
ggcctcgcgcaactgccgatcgatcggctgatgttccacctggcgggccccgagcgcgac
gcgctgcatctgctcgaactgatcgccgggcatacgatcggcgtcgtctgccacgacgcg
gcgcagccgccgcgctggctgcacgcgcttggcgcgcacgcgctcgcgcatcagggcttc
gacgccgatcaggcgctgctgcccgacgaaggccgcagcttccacggttaccggctgctg
cgcgagtacttcgcgtttcccgcgcgcttcctgttcttcagcatcgaaggattgcggccc
gcgctcgcgcgcgcgacgggcgacacgttcgagctgacgctgctgctcgatcggcacgac
gcggcgctcgagaacagcgtcgatgcgcggcacctcgcgttgaactgcacgccggccgtc
aacctgttcgcgcggcgcgcggaccgcattccggtccatccgggcgcgcgcgagcatcat
gtcgtcgtcgatcgcagccggccgctcgactacgaggtctacgcggtgcggcggctcgcg
ggcgagcagcgcgacgacgggcagacgcgcgcgttccggccgttccatgcgtcgttcgcg
ggcgacggcggcaattacggcgcgtactacacggtgcgccgcgagccgcgcctcgtgtcc
gcgcaggcgcgcgcgaacggcacgcgcaccggctacgtcggcagcgagacgttcgtgtcg
ctcgtcgatagcgcgtgcgcgccgtatgacgaatcgatccgctatctgtccgtcgacacg
ctgtgcacgaaccgcgatctcgtcctgctgttgccggcgggcgacgcgaacgcgttcacg
ctgcgcgtgtcggcgcccgtcgagcggatcgccatgatccgcgggccgtcgcggccgcgc
ccgccgctcgccgacgcgcagagcgcgtggcggctcgtgagccatctcgggctcgcgcgc
cacacgctgaccgatgtcgacgacgaagaaggcgcgcgcgtgctgcgcgaattgctcggc
ctgcacgcggacccggccgatgcggcgatgcgccggcagatcgacggtgtgcatcgcgtc
gcgttcgcgccggtgtttcgccggctgcccgccgccgggccgctgatgttcgggcgcggc
gtgcaggtggacgtgaccgtcgacgatcatgcgttttccggcgacagcccctatttgctc
ggtgcggtgctcgagcagtttttcgcgcggcacgtgtcgatcaactcgttcgccgaatgc
gtgctgagcagcgcgcagcgcggcaggctcgcgcaatggccggcgcgcgtcggcaggcgg
cccgcgatatga

DBGET integrated database retrieval system