KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0460
Entry
BMA10247_A0460    CDS       T00479                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10247_A0460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A0460
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A0460
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-ProteinID: ABO03142
UniProt: A0A6C6YLE9
Position
II:406999..409203
AA seq 734 aa
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQ
DESERHLNGIVARAALVGRRAERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVL
GTYGFPIENHLTDTYAPRDYCVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAM
ASHVALPGYEHIPFIARDRTAIADEEHIDSWLPAQEVSIGKHETSDYDYTKPRADLSAQK
IDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAEHERALARTDVRGIAPGYLFT
LEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLPYRSPRATPRP
RTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHS
NAFRFEDKKGAEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQ
NETVNIGKHRVAQIGGNETHGVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTE
TIGQGKTLNVTQHYQTTSKSMKTAVAEHHAEEIGSRTSTIEKAHELNVGGSQSVNVGASH
TMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTVESSASGSHSVRGKTVTSSAT
GEHTVEGTILKLNP
NT seq 2205 nt   +upstreamnt  +downstreamnt
gtgacccgcgtgttcacactcgacagcctgcacggcgacgacctgaagttccaccggctc
tacggcgaggaagcgctcgggcggatgttcgacttccggatcgaagcgctcgccgacaat
cacagcctgtcgctgaaggaactgctcggcaagccggtgacggtgcgcatccggcagcag
gacgaatcggagcgccatctgaacgggatcgtcgcgcgcgccgcgctggtcgggcggcgc
gcggagcggcattacggctatcaactgatcgtgcggccgtggctgtggctcgcgacgcgc
cgctccgattgccggatcttccagaacaagacggtgccggagatcgtgcaggacgtgctc
ggcacgtacggctttccgatcgaaaaccatctgaccgacacgtacgcgccgcgcgactac
tgcgtgcagtacaacgagaccgacgcggcgttcgtgtcgcggctgatggagttcgaaggg
atctactactacttcaagcacgccgcgcaaacgcacacgctgatgctgtgcgacgcgatg
gcgtcgcacgtcgcgctgccgggctacgagcacattccgttcatcgcgcgcgaccgcacc
gcgatcgccgacgaagagcacatcgacagctggctgcccgcgcaggaagtgagcatcggc
aagcacgagacgagcgactacgactacacgaagccgcgcgcggatctgtccgcgcagaag
atcgatccgcgcggccacgaccatgacggcttcgcgtcgttcgaatggcccggcggctat
cgcgacgatgaaccgggcgcgcattacagccgcgtgcggctcgaagagcagcaggcggag
cacgaacgcgcgctcgcgcgcaccgacgtgcgcggcatcgcacccggctatctgttcacg
ctcgaacactgcccgcgcgccgaccagaaccgcgaatacctgatcgtgcgctgccagtat
cggtttcaggagaacgcgtacgcgaccgatagcggcaacgaggcggtcgtgcacgaatct
cagacactcgtgcagccttcgagcctgccgtatcgctcgccgcgcgcgacgccgcggccg
cgcacgaacggcccgcagacggcgaccgtcgtcggcccgaagggcgaggaaatctggacg
gaccagtacgggcgcgtgaagctgcaatttcgctgggaccgctacgggcagagcgaccag
aactcgtcgtgctgggtgcgcgtgtcgagcccgtgggcgggcggcggcttcggcggcgtg
cagatcccgcgcatcggcgatgaggtggtggtcgatttcctgaacggcgaccccgatcag
ccgatcgtgacggggcgcgtgtacaacggcgagaagatgccgccatgggggctgcccggc
agcgcgacacaaagcgggctgctgtcgcgctcgtcgccgggcggcacggccgagcattcg
aacgcgtttcgcttcgaggacaagaagggcgcggagcagctgtggatgcatgcggagcgc
aacttcgacgcggagactgagcaggaccacacgctgtcggtgggccacgatcattcgcat
tcggtcggcaacaacgagatgatgagcgtcgcgaacgaccggcaaaggagcgtcgggcag
aacgagacggtgaacatcgggaaacatcgcgtcgcgcagatcggcgggaacgagacgcat
ggcgtcgcgggaaaccgcacgcggcaggtcggacagaacgaagccgtgacgatcggcgcg
aatcgcgaggcgacgatcggcggcaatcacgtggagacggtcgcgaaagacaagaccgaa
acgattgggcagggcaagacgctgaatgtcactcagcactatcagacgacttcgaagagc
atgaagaccgctgtcgccgaacatcacgccgaggagatcggctcgcgaacgtcgacgatc
gagaaagcgcacgagctcaacgttggcggttctcaatcggtgaacgttggcgcgagccac
acgatgagcgtgaagaacaacgtacatgtcggcgcgggcgatcagatctcgctcgtttgc
ggcgatgcgagcatcacgctgaagaaggacggcacgatcgcgatcaacggcgtcacggtg
gaatcgagcgccagcggaagccatagcgtgcgcggcaagacagtgacgtcgtcggcgacg
ggcgagcacacggtggaaggcacgatactgaaactgaacccctga

DBGET integrated database retrieval system