KEGG   Burkholderia mallei NCTC 10247: BMA10247_A0529Help
Entry
BMA10247_A0529    CDS       T00479                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00260  Glycine, serine and threonine metabolism
bmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn01130  Biosynthesis of antibiotics
bmn01230  Biosynthesis of amino acids
Module
bmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA10247_A0529 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMA10247_A0529 (trpB)
Enzymes [BR:bmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMA10247_A0529 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABO02835
Position
II:476074..477267
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKNDPEFVAEYNRELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIGQALLAKRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GAKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataaccttcccgatgatcgcggccatttcggcccatatggcggcgtgttcgtcgcc
gaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaattcaagaacgac
cccgagttcgttgccgaatacaaccgtgagctgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaggacctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctcggcgcgaccgtcgtg
cccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcgatgcgcgactgg
gtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atgggcatcttctacccgtacatcgacgacgcggccgtccaattgatcggcgtcgaggcg
gcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccagatcatcgagacg
cattcggtatcggccggcctcgactatccgggcgtcggccccgagcatgcctggctgaag
gacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgaatcgagccacgcgatcgcctac
ggcgcgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtcaacctgtcgggg
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system