KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1258Help
Entry
BMA10247_A1258    CDS       T00479                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00790  Folate biosynthesis
bmn01100  Metabolic pathways
Module
bmn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMA10247_A1258
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BMA10247_A1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABO02580
Position
II:complement(1222377..1223009)
Genome map
AA seq 210 aa AA seqDB search
MHQTGNERACGAHDQPHAEIRRVRRFDPIAFEAAVRALLEASGIEIDSAHTGRTAQRVRE
LWQRRLLDGYEVDPAQALGAGFDDPREDMVIVRSIAVHGVCPHHLLPFRGVAHVAYLPGG
RLHGFGRIARMIDAISHRYTYQEWITHRIATALVTHGQARGAACLIEAEQLCLLMGENRR
GDERVITQCYAGEFERDVQARNEFLRGIHR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaacgggaaacgagcgcgcgtgcggcgcgcacgatcaaccgcatgcggaaatc
cggcgcgtgcgccggttcgatcccatcgcattcgaggcggcggttcgcgcgctgctcgag
gcgagcggcatcgagatcgacagcgcgcacaccggccgcactgcgcagcgtgtgcgcgag
ctctggcagcggcgtttgctcgacggctacgaagtcgatccggctcaggcgctgggcgcg
ggcttcgacgatccgcgcgaggacatggtgatcgtccgcagcatcgccgtgcacggcgtg
tgcccgcatcatttgctgccgtttcgcggcgtcgcccatgtggcgtatctgccgggcggg
cgcttgcacggcttcggacgcatcgcgcgcatgatcgacgcgatcagccatcgctatacg
tatcaggagtggatcacgcaccggatcgcgacggcgctcgtgacgcatggtcaggcgcgc
ggcgcggcgtgcctgatcgaggccgagcagctgtgcctgttgatgggcgagaaccggcga
ggcgacgagcgtgtgatcacgcagtgctacgccggcgaattcgagcgcgacgttcaggcc
cgcaacgagtttcttcgcggcatccaccgttag

DBGET integrated database retrieval system