KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1675Help
Entry
BMA10247_A1675    CDS       T00479                                 

Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10247_A1675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A1675
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP THP2
Motif
Other DBs
NCBI-ProteinID: ABO02719
Position
II:1612696..1613205
Genome map
AA seq 169 aa AA seqDB search
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTIT
LTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQ
YSPTPHKDDSNGIKEGLLGYIEEIKFAYSGYSLEHAESGIAGAANWTNG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgctggccggaatatatctcaaggtcaaaggaaaaacccagggggaaatcaaaggctcc
gtcgttcaggaaggtcatgacgggaagatccacatcctcgccttcaagaacgactacgac
atgcccgccaggctccaggaaggcctgacgcccgccgccgccgctcgcggcacgatcacg
ttgacgaaggaaatggacagatcgtcgccgcaattcctgcaggcgctcggcaagcgcgag
atgatggaagagttcgagatcacgatccaccgtccgaagacggatacaacaggtggggac
ctgaccgaactcctgttcacgtacaagttcgaaaaagtgctgatcacccacatggaccaa
tactcgcccacgccgcacaaagacgatagcaacggcatcaaggaaggcttgctcggctat
atcgaggagatcaagttcgcgtattcgggatactcgttggaacatgcggaatcgggcatc
gcgggcgccgcaaactggacgaatggctga

DBGET integrated database retrieval system