KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1676Help
Entry
BMA10247_A1676    CDS       T00479                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A1676
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: ABO01917
Position
II:1613198..1613659
Genome map
AA seq 153 aa AA seqDB search
MADRESSRAGEPRTLERRLLERIANREAGGERDRPPPADVLAHSIIDHLRRILNTRQGHV
PIDPAFGVPDFTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRF
SLDARLVIDAHDVPARFLTTVTGNGKIDIRTIS
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcgcgaatcgtcgcgggccggcgagccgcgcacgctcgagcgccggctgctc
gagcggatcgcgaaccgggaagcgggcggcgagcgcgatcgcccgccgcccgccgacgtg
ctcgcgcactcgatcatcgaccacctgcgccgcatcctgaacacgcggcagggccacgtg
ccgatcgatcccgccttcggcgtgccggatttcacgaatctcgcgggcggcttcgcgcaa
ggctccgcccgcgaaatcgaagcgcagatcgagcgcgtgatcacttgctacgagccgcgg
ctgaaagcgccgcgcgtctcgctcgccgagcgcgggcccgatgcggcgacgctgcgcttc
agcctcgatgcgcggctcgtgatcgacgcgcacgacgtgccggcgcgctttctgacgacc
gtcaccggcaacggaaagatcgatatccgaacgatttcctga

DBGET integrated database retrieval system