KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1686
Entry
BMA10247_A1686    CDS       T00479                                 

Gene name
tssK
Definition
(GenBank) type VI secretion protein TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
bmn  Burkholderia mallei NCTC 10247
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A1686 (tssK)
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A1686 (tssK)
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ABO01554
UniProt: A0A6C6YHE1
Position
II:1628301..1629698
AA seq 465 aa
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIR
SARLLFADRSYVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDA
LPDAPTRYATLPSAEEVADLHSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVR
DGERLRLDDDFAPPCYALSGSRTLLERVRCIRDELAGRARQLQQYKNPREMQRAEFDASY
AAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVGELSVFSECFDMLGETPDARG
GLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRSAQLPPDVFAD
RHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggacaacgtctattggcatcaggggatgctgctgcaaccgcaacattttcagttggcc
gaactgcaccagcagttccgcttcgagccgtggctcgcgtgcggcccgccgcatttctgg
ggcgtcggcgcgctgtcgctcgcgcaggccgcgatcgatcgccgcgtggtcgagatccgc
tcggcgcgcctgctgttcgccgaccgcagctacgtcgaatatccgggcaacgcggtcgtc
gccgcgcgcgcgttcgatcccgcgtggctcgacgaaggccgcgcgctcgtcgcgcacgtc
gcgctcaggcggctcgcgcgcggcgcgaacaacgtgacggtcgcggccgcgcccgacgcg
ttgcccgacgccccgacgcgctacgcgacgctgccgtccgccgaggaggtcgccgatctg
cattcggaccatccgggcgcgccggtgcgcacgctcaagcacgtgctgaagatcgtgttc
gagcacgagctcgacgcgctcgccgcgcacgaaacgatcccgatcgcgcggatcgtgcgc
gacggcgagcgcctgcggctcgacgacgatttcgcgccgccctgctacgcgctgtcgggc
tcgcgcacgctgctcgagcgcgtgcgctgcattcgcgacgagctcgcgggccgcgcgcgg
cagttgcagcagtacaagaatccgcgcgagatgcaacgcgccgaattcgacgcgagctat
gcggcgttcctgctcgcgctgcgctcgctgaaccgcttcggcccgctgctgttccatctc
gccgaatgcgacgggcagcatccatggacggtctacggcgtgctgcgccaactcgtcggc
gagctgagcgtgttctccgagtgcttcgacatgctcggcgagacgcccgatgcgcgcggc
ggcctgccgccgtacgaccaccgcgatctgggcggctgcttctcgcgcgcgcacgcgctg
atcggccacctgctcgacgaaatcgcggtgggcccggactgcgtcgcgacgttcgagccc
gacggcccgcagcagcccgcgcaacgctcggcgcaactgccgcccgacgtgttcgcggat
cgccaccagatctatctcgcgatccgcagcgcgcacgatccggacacgctcgcgcaacgc
ttcgcgctcggcggccggatcgcggcgaccgacgaaatgccgcagctcaccgcgctcgcg
ctgccgggcgtcgaactcacccgcctgcccggcccgccgccgcggctgccgcgccgcggc
gacgcgcgctacttccggatcgagcaggccggccgcccgtgggacgcgatccggcgtgac
ggccgcgtgtcgctgcgctgggccgacgcgcccgacgacctgcacgcggaactcgtcgca
gtgaggcacacgcaatga

DBGET integrated database retrieval system