KEGG   Burkholderia mallei NCTC 10247: BMA10247_A1822Help
Entry
BMA10247_A1822    CDS       T00479                                 

Definition
(GenBank) phosphoesterase family protein
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn00562  Inositol phosphate metabolism
bmn00564  Glycerophospholipid metabolism
bmn01100  Metabolic pathways
bmn01110  Biosynthesis of secondary metabolites
bmn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BMA10247_A1822
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMA10247_A1822
   00565 Ether lipid metabolism
    BMA10247_A1822
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMA10247_A1822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bmn02042]
    BMA10247_A1822
Enzymes [BR:bmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BMA10247_A1822
Bacterial toxins [BR:bmn02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BMA10247_A1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase ENOD93
Motif
Other DBs
NCBI-ProteinID: ABO02756
Position
II:1751796..1753463
Genome map
AA seq 555 aa AA seqDB search
MFRRAWIATACAGSAIALYACGGTDSNAPVTSQNALRTATPIKHLVVIYGENVSFDHYFG
TYPNAANPPGEPAFSAASGTPSINGLSGLLLTANPNATNPANGAGASNPFRLDRTQAATA
DQNHAYTAEEQAYDNGLADLFPKYTGNGSSGGAGAFGTTGQVMGYFDGNTVTALWNYAQR
FAMSDNAYTSTYGPSTPGALNVIAGQTDGMQIVKTSKAVSTLAKTSYYINDGQGGLTMIN
DVDPGYDVCSSTTDQAMMSGKNIGDLLNARNVTWGGFMGGFNLSTTNANGTTGCKRSTIA
TAVNAATTDYIPHHNWFQYYASTANPQHTRPSSIAAIGSSVQTDGKTPEPANHQYDSDDF
FAAVKAGNFPSVSFLKAPATQDAHAGYSDPLDEQQFVTKVVNFLQQQPDWASTAVIVTYD
DSDGWYDHAYTAPTRASFDAVDQLNGNGACGSGAATTGINGAAVNGRCGPGTRIPFVVVS
PWAKQNYVSHTLIDQASVVRFIEDNWLGGQRIGGGSFDATAGNMRDLFDFSGAVNKTPLY
LDPTLGTKLATAPSI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgagcctggatcgccaccgcgtgcgccggatcggccatcgccctctatgcg
tgcggcggcaccgacagcaacgcgcccgtcacgtcgcaaaacgcattgcggaccgcgacg
ccgatcaagcatctcgtcgtgatctacggcgagaacgtgtcgttcgaccactacttcggc
acctacccgaacgccgcgaacccgccgggcgagccggcgttcagcgccgcgtcgggcacg
ccgtcgatcaacggcctgtcgggcctgctgctcaccgcgaacccgaacgcgacgaatccg
gcgaacggcgcgggcgcgagcaatccgttccgcctcgaccgcacacaggccgcgacggcc
gatcagaaccacgcgtacaccgccgaggagcaggcgtacgacaacggcctcgccgatctc
ttcccgaaatacacgggcaacggctcgagcggcggcgcgggcgcgttcggcacgaccggc
caggtgatgggttacttcgacggcaacacggtgaccgcgctgtggaactacgcgcagcgc
ttcgcgatgagcgacaacgcatacacgtcgacctacggcccgtcgacgccgggcgcgctg
aacgtgatcgccggccagaccgacgggatgcagatcgtgaagacgtcgaaggccgtgtcg
acgctcgcgaagacgtcgtactacatcaacgacggccagggcggcctcacgatgatcaac
gatgtcgaccccggctacgacgtgtgctcgagcacgaccgatcaggcgatgatgtccggc
aagaacatcggcgatctgctgaacgcgcgcaacgtcacgtggggcggcttcatgggcggc
ttcaatctgtcgacgacgaacgcgaacggcacgacgggctgcaagcgcagcacgatcgcg
accgcggtgaacgcggcgacgaccgactacatcccgcaccacaactggttccagtactac
gcgtcgaccgcgaacccgcagcacacgcgcccgagctcgatcgcggcgatcggctcgagc
gtccagacggacggcaagacgcccgagcccgcgaatcaccagtacgattcggacgacttc
ttcgcggccgtgaaggcgggcaacttcccgtcggtcagcttcctgaaggcgcccgccacg
caagacgcgcacgccggctactcggatccgctcgacgagcagcagttcgtgacgaaggtc
gtcaacttcctgcagcagcagcccgactgggcgagcaccgcggtgatcgtcacgtatgac
gactcggacggctggtacgaccatgcgtacaccgcgccgacgcgcgcgtcgttcgatgcg
gtcgaccaactgaacggcaacggcgcgtgcggctccggcgccgcgacgacgggcatcaac
ggcgccgccgtcaacggccgctgcggtcccggcacgcggattccgttcgtcgtcgtgtcg
ccgtgggcgaagcagaactacgtgagccacacgctgatcgatcaggcgtcggtcgtgcgc
ttcatcgaggacaactggctcggcggccagcggatcggcggcggctcgttcgatgcgacc
gcgggcaacatgcgcgatctgttcgatttctcgggcgcggtgaacaagacgccgttgtac
ctcgatccgacgctcggcacgaagctcgcaaccgcgccttcgatctga

DBGET integrated database retrieval system