KEGG   Burkholderia mallei NCTC 10247: BMA10247_A2004
Entry
BMA10247_A2004    CDS       T00479                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
bmn  Burkholderia mallei NCTC 10247
Pathway
bmn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bmn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BMA10247_A2004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bmn02044]
    BMA10247_A2004
Secretion system [BR:bmn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BMA10247_A2004
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABO02742
UniProt: A0A6C6YKC7
Position
II:complement(1933149..1933742)
AA seq 197 aa
MRHKMGPFKSIAAALALGVLAGCSAFSSSKPEEPRQLHVTLVGGARLNVAPTGEPRPVQT
CVYVVTAADWLPTQGGDDSSCASRGQDSTVVADSRHVIAPNQLLQFSLNLPRSGELWLVA
DADYARRPANYGPLRVRVEGRGLIHMAVWLDRDGIYNALLPGPVPVGGAIAPAAVRPDEP
PPERKTKTTYGTRRSRQ
NT seq 594 nt   +upstreamnt  +downstreamnt
gtgcgtcacaagatgggccccttcaaatcgatcgcggcggcgctcgcgctcggcgtgctc
gccggctgctcggccttctcgtcgtcgaagccggaagagccgcggcagttgcacgtgacg
ctcgtcggcggcgcccggctgaacgtcgcgccgacgggcgagccgcgtccggtgcagacg
tgcgtgtatgtcgtgaccgcggccgactggctgccgacgcagggcggcgacgattcgtcg
tgcgcgtcgcgcgggcaggacagcacggtcgtcgccgactcgcggcacgtgatcgcgccg
aaccagttgctgcagttctcgctgaacctgccgcgctcgggcgagctctggctcgtcgcc
gacgccgactacgcgcgccggccggcgaactacgggccgctgcgcgtgcgcgtcgagggc
cgcggcttgattcacatggctgtctggctggaccgcgacggcatctacaacgcgttgttg
ccggggcccgtgcccgtcggcggcgcgatcgccccggcggcggtccgccccgacgagccg
ccgcccgagcgcaagacgaaaaccacctatgggacaaggagaagcaggcaatga

DBGET integrated database retrieval system